KEGG   Campylobacter concisus 13826: CCC13826_2021Help
Entry
CCC13826_2021     CDS       T00593                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cco  Campylobacter concisus 13826
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cco00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1301460..1302599)
Genome map
AA seq 379 aa AA seqDB search
MKFYKINNKSDFDQICKAISPSPAGAKLMQKKSEINFIFIDEIKTPAANILKQDALSVGA
ELVTHNDTILGKESLNKALLMATNAQLRQLAKKEKLQDFGLKKLAGFLETKFTKPTKPLI
MGVANINRDSFNEQSRINTQNGIAKIEAMIEAGADYIDLGGVSSRPGSEYCGREEEFRRI
KDIVEEIYRLNLHEKAKFSLDSFDEYCLEFALNHGFKMINDITANANLAPLAARYDAEFC
MMHMQGDPATMQIAPKYNDLIGEISDFFEQKIVLARELGAKKIVLDVGIGFGKTAEQNLL
LIKHLEHFLKFGCPLLVGASRKSVINHYYKSEVKERLPGSLYLHLKAFENGAQIIRTHDV
AEHKQLFDMHEAMSQATLW
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattttataagataaataacaaaagcgactttgatcaaatttgcaaggccatctcg
ccaagtccggctggtgcgaagctcatgcaaaaaaagagtgagataaattttatttttatc
gatgagataaagaccccagcggcaaatatcctaaaacaagacgccctaagtgttggcgcc
gagctggtgacgcataatgatacgatcttgggtaaagagagtctaaacaaagccttgcta
atggcgacaaacgcgcagcttaggcagctagctaaaaaagagaagctacaagactttggg
cttaaaaagcttgcaggttttttagagactaaatttacaaagcccacaaagcctcttata
atgggcgtggcaaatataaatagagatagttttaacgagcaaagccgcataaatacgcaa
aatggcatagcaaaaatcgaagcgatgatcgaagcaggtgctgactacatcgaccttggc
ggcgttagctcaaggccagggagtgagtattgcggacgcgaggaggagtttaggcgcata
aaagatatcgtggaggaaatttataggctaaatttacacgaaaaggcgaaatttagcctt
gatagctttgatgagtattgcttggaatttgcgctaaatcacggctttaagatgataaac
gacatcacagcaaatgcaaatttagccccgcttgctgcaagatacgatgccgagttttgt
atgatgcacatgcaaggcgatcctgctaccatgcagattgcgccaaaatataacgaccta
atcggtgaaatttcagacttttttgagcaaaagattgtcctagcaagggagcttggcgct
aaaaagatagtgcttgacgttggcattggctttggtaagacagctgagcaaaatttgctg
cttattaagcatttggagcattttttgaaatttggctgcccgctgctagttggtgctagc
cgcaaatcagtcataaatcactactataaaagcgaggtcaaggagcgcttaccaggttcg
ctttatctgcacttaaaagccttcgaaaacggtgcgcagatcataagaacgcacgatgtg
gcagagcacaagcagctttttgatatgcacgaggcgatgagccaagccacgctttggtag

DBGET integrated database retrieval system