KEGG   Campylobacter concisus: CCC13826_2052Help
Entry
CCC13826_2052     CDS       T00593                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cco  Campylobacter concisus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCC13826_2052 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCC13826_2052 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CCC13826_2052 (thrC)
Enzymes [BR:cco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CCC13826_2052 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1272966..1274429)
Genome map
AA seq 487 aa AA seqDB search
MRLTPTRSVKDEKVKNVNLSTAMLSPSSAHGGLYAPKKLPKITKAKWQELSSLSYEKLAL
HIISLFKFDVSEAFFKKALKRYASFDDPKHPVIFKKIDKNLYVNELYHGPTRAFKDMALQ
PFGSLLSQLAKERSERYLIMCATSGDTGPATLQTFANDENIKVVCLYPDGGTSEVQKLQM
QTMQGENLKVFGIKGDFDDAQRALKTLLANDKFKSELKKKRLKLSAANSVNFGRILFQII
YHAYAYANLLKQKALKANESFDIIVPSGNFGNALGAYYAKKMGAKIGKIKIASNANNILT
QFFTTGVYDLRDKKLIKTISPAMDILISSNVERLLFDKFGSERTNELMQSLAKNKFYKLS
KQELEALKEDFEASWCDDKECEAYIAKLAKDGYAIDPHTATCFKMVDASRINVITSTAHW
VKFTPSMIEACQIKDTKDEKDALAKTAKILNDSVPSSINSLFSAKILHKNIIKEDEIEKC
VLEWIER
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagactaacaccaactagaagcgtaaaagatgaaaaggtaaaaaatgtaaatttaagc
acagccatgcttagcccaagctctgctcacggcggactttacgcgccaaagaagctacca
aagatcacaaaggcaaagtggcaagagctctcaagcctaagctacgaaaagctcgcactt
cacatcatatcgctatttaaatttgatgtatctgaggcgttttttaaaaaagctcttaag
agatatgcaagctttgatgacccaaagcacccagtcatttttaaaaaaatagataaaaat
ttatacgtaaatgagctctatcacggcccaactagggcatttaaggatatggcgcttcag
ccttttggctcgctgcttagccagctagcaaaggaaaggagcgaaagataccttatcatg
tgcgcaactagcggcgacacgggccctgcgacacttcagacttttgcaaatgatgaaaat
ataaaggtcgtctgtctctatccagacggcggcacgagcgaggtgcaaaagcttcagatg
cagaccatgcagggcgaaaatttaaaggtttttggcataaaaggcgactttgacgacgct
caaagagcgctaaaaacgctgcttgcaaatgataaatttaaatctgagcttaagaaaaag
cgccttaaactaagcgcggcaaactcggtaaattttggcagaattctctttcagatcatc
tatcacgcttacgcctacgcaaatttgctaaaacaaaaggcgcttaaagcaaacgagagc
tttgacatcatcgtgccaagtggaaatttcggcaacgctcttggggcatactatgctaaa
aaaatgggcgcaaagatcggcaaaatcaagatcgcctcaaacgcaaacaacatcttgacg
cagtttttcaccaccggcgtttatgacctcagggacaaaaagctgattaagacgataagc
ccagccatggacattttaataagctcaaacgtcgagcgcttgctgtttgataaatttggt
agcgagcgaactaatgagcttatgcaaagtctagctaaaaataaattttataagcttagc
aagcaagagcttgaagcgctaaaagaggactttgaggctagctggtgcgatgataaggag
tgcgaggcatatatcgcaaagctcgcaaaggatggctacgcgatcgatccgcatacggcc
acttgctttaaaatggtggatgctagccgcataaatgtcatcacatcgaccgcgcactgg
gtgaaatttacgccaagcatgatcgaggcgtgccagatcaaagatacaaaagatgaaaaa
gatgcgctggcaaagaccgctaaaattttaaatgacagcgtgccaagctcgataaactcg
ctatttagcgcgaaaattttacataaaaatatcataaaagaggacgagatcgaaaagtgc
gtcctagaatggatcgagcgatga

DBGET integrated database retrieval system