KEGG   Campylobacter concisus: CCC13826_2191Help
Entry
CCC13826_2191     CDS       T00593                                 

Definition
two-component sensor
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cco  Campylobacter concisus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CCC13826_2191
   00565 Ether lipid metabolism
    CCC13826_2191
   00590 Arachidonic acid metabolism
    CCC13826_2191
   00591 Linoleic acid metabolism
    CCC13826_2191
   00592 alpha-Linolenic acid metabolism
    CCC13826_2191
Enzymes [BR:cco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CCC13826_2191
    3.1.1.32  phospholipase A1
     CCC13826_2191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1780499..1781461)
Genome map
AA seq 320 aa AA seqDB search
MSKFALLLSFSLTFLMASRTDDFKRAQELEQSGDIKGAMQIYKELAKSSLGEQEVVQNAQ
ASEPAPNDAKLKQADLLRDKSDKNLQNALGIELYKFNYLLPVTYAKTIPDDGRKSVETKF
QISLAKPLFYDVFGLRESLVAAYTQTSWWQITKTSAPFRETNYQPEIFLNFASPKYLEQI
GVKNLKFGLLHESNGRDGTNSRSWNRAYVQGDLVYGDLTISPRVWSVIGEKNDNKEILNY
IGHGDLRLSYKLNDQIFSLMLRNNLHFDKTNKGAAEISYMFPIFSSGVYGYLQYFTGYGE
SLIDYDRHTDKVGLGFVILK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatttgcattacttttaagctttagccttacatttttgatggcaagcaggacg
gatgactttaaaagggcgcaggagcttgagcaaagtggcgatataaagggtgcgatgcaa
atttataaagagctagccaaaagctctttgggcgagcaagaagtggtgcaaaacgcgcaa
gcaagcgagccagcaccaaatgatgcgaagctaaagcaggctgatcttttaagagataaa
agcgataaaaatttacaaaatgcacttggcattgagctttataaatttaactaccttttg
ccagtaacttacgctaaaactatcccagatgacgggcgaaagagcgttgagacgaagttt
caaataagccttgcaaagccgctattttacgacgtttttgggcttagagagagccttgtg
gcagcatatacgcaaacttcttggtggcagataacaaaaacctctgctccgtttcgtgag
acaaactatcagcctgaaattttcttaaatttcgcctctccaaaatacctagagcaaata
ggcgtgaaaaacctaaaatttggacttttgcatgagtcaaacggacgagatggcaccaac
tcaaggagctggaacagagcctacgtgcaaggcgatcttgtctatggagatttaaccatt
tcgccaagagtttggagcgtgatcggcgaaaagaacgacaataaagaaattttaaactac
atcggacacggagatctaaggcttagttacaagctaaatgatcaaatttttagcctaatg
ctaagaaataacttacattttgataaaacaaataaaggtgcagctgaaatttcatatatg
tttccgatattttcaagcggcgtttatggctatttgcagtattttacaggatacggcgag
agtttgattgactatgataggcacactgacaaggttggtcttggctttgttattttaaaa
tag

DBGET integrated database retrieval system