KEGG   Campylobacter concisus 13826: CCC13826_2286Help
Entry
CCC13826_2286     CDS       T00593                                 

Definition
protein CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cco  Campylobacter concisus 13826
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cco00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1799007..1799810)
Genome map
AA seq 267 aa AA seqDB search
MSELLNLAIKAAISAGGEIMKFYSSNSQALKVCLKDDSSPLTSADLAANEVILKELSKSG
IKICSEESILQDSDKDEFWLVDPLDGTKEFLARNGEFCVCIALIKEARPVLGVIFIPVSK
ELFYADENGAFKEILGTNDEVVEKQDLNEKAKSLNNFIFSSRRGETKRVDLIRDSLNLEQ
KCIGSAIKFCRLAELGGIYVRFSPSYLWDNAAGEAVVKFSGGKVLNASDRCEPSYKLADL
KSPFYVAFGKNALSLEDEVFKLIEQGR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcttttaaatttagccatcaaggcagccatcagcgctgggggtgagataatg
aaattttactcatctaatagccaggcgcttaaagtctgcctaaaagatgacagctcgcca
ctaactagcgctgatctagcggcaaatgaggtgatactaaaagagctaagcaaaagtggg
ataaaaatttgctctgaagagagcatcttacaagatagcgacaaagatgagttttggcta
gttgatccccttgatggcacgaaagaatttttagctagaaacggtgaattttgcgtttgt
atagcgcttataaaagaggctaggccggtgcttggtgtcatttttatcccagttagtaaa
gagcttttttacgctgatgaaaacggcgcttttaaagaaattttaggcacaaatgatgag
gtcgtagaaaaacaagatctaaatgaaaaagctaaaagcttaaataacttcatcttttca
agcagaagaggcgagacgaagagggttgatctcataagagatagtttaaatttagagcaa
aaatgcatcggatctgccattaaattttgtcgtttggctgagcttggcgggatatatgtg
agatttagcccaagctatctttgggacaacgctgcaggtgaggcggtagtgaaatttagc
ggtggcaaggtcttaaatgctagcgatagatgtgaaccaagctataagctagctgatcta
aaaagcccattttacgtagcatttggcaaaaatgctttgagcttagaagatgaagttttt
aagcttatagagcagggtagataa

DBGET integrated database retrieval system