KEGG   Campylobacter coli 76339: BN865_03160cHelp
Entry
BN865_03160c      CDS       T02811                                 

Definition
(RefSeq) Glutamate 5-kinase (EC:2.7.2.11)
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ccol  Campylobacter coli 76339
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ccol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN865_03160c
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN865_03160c
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BN865_03160c
Enzymes [BR:ccol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BN865_03160c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(285315..286070)
Genome map
AA seq 251 aa AA seqDB search
MQRIVIKVGSHVISDENLLNLKRFENLVAFLAKLMQKYEVILVTSAAISAGCTKLHIDRK
NLINKQVLAAIGQPFLISVYNEFLAKFGKMGGQILLTGKDFDSRKATKHAKNAIDAMIDL
GILPIINENDATAIEEIVFGDNDSLSAYATHFFEADLLVILSDIDGFYDKNPSEFSDAKR
LERVEFVKEEWLNVSVKTGSEHGTGGIVTKLKAAKFLLENDKKMFLASGFDLSVAKAFLL
EDKQIGGTLFE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaatagttataaaagtaggttctcatgtgatcagtgatgagaatcttttaaat
ttaaagcgctttgagaatttagtggcttttttggctaaattaatgcaaaaatatgaagtt
attttagttacttcagctgctatttcagcaggatgtactaaacttcatatagatagaaaa
aatttaattaataaacaagttttagctgctataggacaaccttttttaatcagtgtttat
aatgaatttttagccaaatttggcaaaatgggtggacaaattttgcttacaggaaaagat
tttgactcaagaaaggcgactaaacatgctaaaaatgctattgatgcgatgattgattta
ggaattttgcctattatcaatgaaaatgatgccacggctattgaagagattgtttttggg
gataacgatagcttaagtgcttatgcgacgcatttttttgaagctgatttgcttgtgatt
ttaagtgatattgacggtttttatgataaaaatcctagcgaatttagtgatgcaaagcgt
ttagaaagggttgagtttgtcaaagaagaatggcttaatgtgagtgttaaaacaggaagc
gaacacggaacaggcggtatagtcaccaagctaaaagcggctaaatttttattagaaaat
gataaaaaaatgtttttagcaagtggttttgatttaagtgttgcaaaggcatttttacta
gaagataaacaaataggcggaactttatttgagtga

DBGET integrated database retrieval system