KEGG   Campylobacter coli 76339: BN865_07590Help
Entry
BN865_07590       CDS       T02811                                 

Definition
Putative periplasmic protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ccol  Campylobacter coli 76339
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709558..710235
Genome map
AA seq 225 aa AA seqDB search
MSLFAASNSEISDFYSKSIKAQFPNATVSVGNRQKVGNTGFESVIVTITLEGQKQEQILF
TKDNLIVPDIIDLKTKTSYAQEYEMKKFQEARANFTKNVKPVVQKETMLIALGDKNKPAI
YVFSDPECPYCRDHLAQIKDELKNYQVNYILTPVHGKSAFEKSALIYKESKKAKSDDEKI
AILNKYYDANIKSYPKVSDNELKEVFSLYEKYRSLGLSATPTIIK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatttgctgctagtaattctgaaatcagtgatttttattctaaaagtattaag
gcgcaatttccaaatgcaacagtgagcgtaggtaatcgccaaaaggttggaaatacaggc
ttcgaaagcgtgattgttacgataacgcttgaaggacaaaagcaagagcaaattcttttt
acaaaagacaatcttatcgttcctgatattattgatttaaaaactaaaacttcttatgct
caagaatatgaaatgaaaaaattccaagaggctagggcaaatttcactaaaaatgttaaa
cccgtagttcaaaaagaaacaatgcttatagctttaggcgataaaaataaacctgctatt
tatgtattttcagatccagaatgtccttattgtagagatcatttggcacagattaaagat
gaacttaaaaattatcaagtcaattatatcttaaccccagtgcatggtaaatcagctttt
gaaaaatcagcattgatttataaagagagcaaaaaagctaagagtgatgatgagaaaata
gctattttaaataaatattatgacgcaaatatcaaatcttatccaaaggtgagcgataac
gagttaaaagaagtattttctctttatgaaaaatatcgttctttaggccttagtgctact
ccaaccatcatcaaataa

DBGET integrated database retrieval system