KEGG   Campylobacter coli 76339: BN865_07590Help
Entry
BN865_07590       CDS       T02811                                 

Definition
Putative periplasmic protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ccol  Campylobacter coli 76339
Brite
Enzymes [BR:ccol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BN865_07590
Secretion system [BR:ccol02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BN865_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709558..710235
Genome map
AA seq 225 aa AA seqDB search
MSLFAASNSEISDFYSKSIKAQFPNATVSVGNRQKVGNTGFESVIVTITLEGQKQEQILF
TKDNLIVPDIIDLKTKTSYAQEYEMKKFQEARANFTKNVKPVVQKETMLIALGDKNKPAI
YVFSDPECPYCRDHLAQIKDELKNYQVNYILTPVHGKSAFEKSALIYKESKKAKSDDEKI
AILNKYYDANIKSYPKVSDNELKEVFSLYEKYRSLGLSATPTIIK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatttgctgctagtaattctgaaatcagtgatttttattctaaaagtattaag
gcgcaatttccaaatgcaacagtgagcgtaggtaatcgccaaaaggttggaaatacaggc
ttcgaaagcgtgattgttacgataacgcttgaaggacaaaagcaagagcaaattcttttt
acaaaagacaatcttatcgttcctgatattattgatttaaaaactaaaacttcttatgct
caagaatatgaaatgaaaaaattccaagaggctagggcaaatttcactaaaaatgttaaa
cccgtagttcaaaaagaaacaatgcttatagctttaggcgataaaaataaacctgctatt
tatgtattttcagatccagaatgtccttattgtagagatcatttggcacagattaaagat
gaacttaaaaattatcaagtcaattatatcttaaccccagtgcatggtaaatcagctttt
gaaaaatcagcattgatttataaagagagcaaaaaagctaagagtgatgatgagaaaata
gctattttaaataaatattatgacgcaaatatcaaatcttatccaaaggtgagcgataac
gagttaaaagaagtattttctctttatgaaaaatatcgttctttaggccttagtgctact
ccaaccatcatcaaataa

DBGET integrated database retrieval system