KEGG   Chondrus crispus (carragheen): CHC_T00000525001Help
Entry
CHC_T00000525001  CDS       T02916                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
ccp  Chondrus crispus (carragheen)
Brite
Enzymes [BR:ccp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CHC_T00000525001
Peptidases [BR:ccp01002]
 Cysteine Peptidases
  Family C86
   CHC_T00000525001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 194 aa AA seqDB search
MAQGKRAPPPRRDVRVYHERQQLWRCGLHATNALLKRRAYSAADFSKIADDLMAGQRSSW
FHPHRSMLGLGDYDVNVLMVALDKYAIQTNWVSETASLEEIIRANPKMKGFLVNVPSQFG
LPSFMAPANSLFGDRKHWIAVPRYYSHFHLVDSKTTPSRFEKEVDLIRYLEKVRKASGHV
LYLVDKSESDQPVD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggcaaacgagcgccccctcctaggcgcgacgtccgcgtctaccacgagcgt
cagcagctttggcgctgcggcctgcacgccacgaatgcccttttgaagcggcgtgcctac
tcagccgccgacttttcgaaaatcgccgacgatttgatggcagggcagcgctcgtcgtgg
ttccatccacaccgttcaatgctcggcctaggcgactacgacgttaacgtgctgatggtt
gcgttggacaagtacgccatacagaccaactgggtctccgagacggcctcgctggaggag
attatacgggccaatccgaaaatgaagggctttttagtgaacgtgccttcccagtttggc
ctcccatcgttcatggcacccgcgaacagcttgttcggggatagaaagcattggattgct
gtcccccggtactacagtcatttccacttggttgattccaagacgacgccgtctcggttc
gagaaggaggtggatctcatccgatatttagaaaaagtccgcaaagcatcggggcacgtt
ttgtaccttgtggataaatctgaatcggaccaaccagttgattga

DBGET integrated database retrieval system