KEGG   Chondrus crispus (carragheen): CHC_T00004880001Help
Entry
CHC_T00004880001  CDS       T02916                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CHC_T00004880001
Enzymes [BR:ccp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CHC_T00004880001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 480 aa AA seqDB search
MPEPVKRNVAVLGGGPAGLSAAFRLLHDLPPGLSVKVDLYEATGRLGGAVTSACDAGFCY
ELGPNSMNAKHPSVADLIQEKLRLKPRMLPRSPYAKRYYFMRDGKLVPLPLSPLHFATTG
LLSWRAKWHVVKEPFVARLQDVRDSHMESVASFFQRRFGREVVDYLVDPMVAGTYSGKPA
DLSMKHALRKVWRLEQKHGSVIGALLRGAGKTKPDPRYKPYTGKELRASFTYDKGMEVVT
DALVANINDLNPRGGRLYTHGKVRTLDRDPNGAWRINGRGKYDAVISTIPTHAVKSIYTN
MSALGKGFKKLNKSIKYAPVSVVVMGFDKSQVPHPLDGFGALIPTVEGRQILGINFSSSN
YPQRLSDPDKVFLTVYVGGQRNPDLPFRRAKEIVDISKKELGHVLGVKGDPFFSRVKTWK
RGIPQYDPQFDESLCTMARAEKSAKGFVFGGNYRDGVGLPDALRSGILSAEKTLQYLKTL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcccgtcaagcgcaacgtcgccgtcctaggcggcggccctgcgggcctatcc
gctgccttccgcctcctgcacgacctcccgccgggcctgtcggtcaaggtcgacctgtac
gaggccacaggccggctgggcggcgccgtcacctcggcgtgcgacgccggcttctgctac
gagctcgggcccaactcgatgaacgccaagcaccccagcgtcgccgatctcatccaagag
aagctgcgcctcaagccgcgcatgctgccgcgctcgccgtacgcgaagcgctactacttc
atgcgcgacggcaagctcgtcccgctgccgctgtctccgctccacttcgccaccactggc
ctgctctcgtggcgcgccaagtggcacgtcgttaaggagccgtttgtggccaggctgcag
gacgtcagagactcgcacatggagtccgtcgcctccttctttcagagacggttcgggcgc
gaggttgtcgactaccttgtcgacccgatggtcgcgggcacttattcgggcaagccggca
gatttgtccatgaagcatgccttgcgaaaggtgtggcgcttggagcagaagcacgggtct
gtcattggcgccttgctgcgcggagccggcaaaacgaagccggatccaaggtacaagccg
tacacagggaaggaactgcgtgctagttttacatatgataaggggatggaggtcgttacc
gatgccctcgtcgcaaacatcaatgacctcaatcctagaggggggaggttgtatacgcac
ggcaaggtccgcacgctcgatagagacccgaatggtgcctggcgaattaacggacggggc
aagtacgacgctgtcatatccaccattcccacgcatgccgtcaaatctatttacactaat
atgtcagctttggggaaagggttcaagaagctgaacaagagtatcaagtacgcacccgtc
tctgttgtagtcatgggctttgacaagtcccaggtcccgcatccgctcgatggcttcggt
gctcttatacccacggtagaaggtcgccagattctgggaatcaacttttcctcgtccaac
tatccccaacgactaagcgacccggacaaggtctttttgacagtgtacgtcggggggcaa
cgtaaccctgacctcccgttccggcgcgcgaaagagattgttgatatctcgaagaaggaa
ttgggtcatgtcctcggcgtcaagggggatccttttttctctcgcgtcaagacatggaag
cggggcatcccccagtacgatccacaatttgatgaatcgctttgcactatggcccgagct
gaaaaatcagccaaaggcttcgtctttggaggcaattatcgtgatggcgtaggtctcccc
gatgcgctccggtctgggattttgtcggcagaaaaaacactccaatacctcaaaaccttg
tag

DBGET integrated database retrieval system