KEGG   Chondrus crispus (carragheen): CHC_T00005609001Help
Entry
CHC_T00005609001  CDS       T02916                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ccp  Chondrus crispus (carragheen)
Brite
Enzymes [BR:ccp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CHC_T00005609001
Peptidases [BR:ccp01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CHC_T00005609001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 227 aa AA seqDB search
MSAQQWIPLESNPEVLTGFGHALGVSPDLVFSDVWSLELLDMVPAPCHAVLLLFPLTPKL
RNAEVADSTSLTDSPDAPYFVRQTIGNACGTIALIHAALNAGRLAPAPSPDSFLSRFGEA
TKDMTPDDRAKALMEDASLDAVHGQFAAQGQTAAPSPTEKVDLHFVAFVHKAGKLWLLDG
RRDKPFECGPCEEGNVLRSSAKIVMDRFMKADPTEQRFTILALTAKP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgcagcaatggatcccgctcgagtcgaatccggaagtcctcaccggcttcggc
cacgccctgggcgtctctcccgacctagtgttttccgacgtctggagcctcgagctgctt
gacatggtccccgccccttgtcacgccgtcctccttctcttccctctcacgcccaagctc
cgcaacgcggaggtagccgattctacctccctcaccgactccccagacgccccctacttt
gtccgccagacgatcggtaatgcctgcggcaccattgctctcattcatgccgcgctcaac
gcgggtcgtctggctcccgccccgtcgcctgattcctttctatctcgattcggtgaagcg
acaaaagatatgactccggacgatcgtgcaaaggccctcatggaggatgctagtctagat
gccgtgcatggccagtttgcggcacagggtcagacagctgctccttcgcctactgaaaag
gtcgatttgcattttgtcgcttttgtacacaaggcgggcaaactctggttgctcgatggc
cgtagagataaaccctttgaatgcggcccgtgcgaggagggaaacgttttgcgcagctct
gccaaaatcgtcatggatcgcttcatgaaggcagatcctacagagcaaaggttcactatc
cttgccctcactgcgaagccatga

DBGET integrated database retrieval system