KEGG   Chondrus crispus (carragheen): CHC_T00006493001Help
Entry
CHC_T00006493001  CDS       T02916                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    CHC_T00006493001
Enzymes [BR:ccp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     CHC_T00006493001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 134 aa AA seqDB search
MVGVGAICCNYWTDKQREVFRATNGQVTIWGQKPVSIEAQYVTGDGKKRRSLLLASGWWG
VSRHVNYVFEIALTFCWSVPAGGTGVIPYVYVMFLTILLTDRAYRDEVRCSEKYGKYYEE
YCRLVPYKMIPGVY
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcgttggggccatctgctgcaactactggacggacaagcagcgcgaggtgttt
cgtgcgacgaacggacaggtaacaatctggggtcagaaacccgtgagcatcgaggcacag
tacgtgacgggggatggcaagaagcgacgcagtttgctgttggcaagtggatggtggggc
gtgtcgagacatgtgaactacgtgtttgagattgcgctcaccttttgttggagcgtgccc
gcaggtgggacaggcgtgatcccgtacgtgtatgtgatgttcttgacgatattattgacg
gatcgggcgtatcgtgacgaagttcgatgctcggagaagtatggcaagtactacgaagag
tattgccggttggtaccgtacaagatgattcccggtgtgtactag

DBGET integrated database retrieval system