KEGG   Chondrus crispus (carragheen): CHC_T00008383001Help
Entry
CHC_T00008383001  CDS       T02916                                 

Definition
(RefSeq) Choline/ethanolamine kinase, putative
Organism
ccp  Chondrus crispus (carragheen)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MSSLVEKKPRIPRFEYDINTEEEIPKLREVIPGWGTSSSEDSALIVEPIIGGITNRIYKL
SNPRQNPCSVLVRIFGGETIFTPSERQQENAVFEELGKIGVAPKLIALFGNGRVEAFLNS
RAIVLDEMVDPVVMTGVARAMAKLHKFEPSGGLELSRSPGVWADIDKWVPEVLNLREKNS
AFVEKLSVNLDKCVKGLQDIRKALAERQSSSPIVFCHNDLLCGNILRSLNQGTAVSIVDF
EYSSFNYRGFDIGNFFCEAMGGTQDGYIDASRYPSSSARRLFCRKYLEEFCGCQPEEYAV
SELVAEAEEYGMLAHLYWGFWGLVQSVTSPVDFPYALFADQRFTRFFEKYSP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccttggtcgagaaaaaaccccgcattccaaggtttgagtacgatatcaacacg
gaggaggaaatcccaaagctgcgcgaagtcataccgggctgggggacgtcatcatctgag
gatagtgcactcattgttgaaccgatcatagggggaattacaaatcgcatctacaaacta
tcgaacccgcgtcaaaacccctgctcagttctcgtgcggatcttcggaggagagaccatt
ttcacaccctccgagagacagcaagagaacgccgttttcgaagagctcgggaaaatcggt
gttgctcccaagttgatagcgctgttcggcaatgggcgtgttgaagcgtttcttaactca
cgagccattgtgttggacgaaatggtcgaccctgtggtcatgacaggtgtcgctcgtgcc
atggcgaagttgcataagttcgagccaagcggagggttggagttgagtcggtctccaggt
gtatgggcggacatagataagtgggtaccagaagtactgaatttgcgagagaaaaactca
gcatttgttgaaaagctatcagtgaacttggacaaatgcgtcaaggggctgcaagatatt
agaaaagctctggctgagaggcaatcatcgagcccgattgtattttgtcacaacgatttg
ctctgcggtaatattttaaggtccctgaaccaggggacagctgtgtcgatcgtcgatttt
gagtatagctccttcaactataggggctttgatattggaaactttttctgtgaggcgatg
gggggaacgcaagatggatatattgacgcctcaaggtatccatcgagtagtgcgcgacgc
ttgttctgcaggaagtatctggaggagttttgtgggtgtcagccggaggagtatgctgtt
tctgagctcgttgcggaggcagaggagtacggaatgttggcgcacttgtactggggcttt
tggggactcgtacagagcgttacttctcctgtcgactttccgtatgcgttgtttgctgat
caacgatttacacgctttttcgagaaatactcaccgtga

DBGET integrated database retrieval system