KEGG   Chondrus crispus (carragheen): CHC_T00008383001Help
Entry
CHC_T00008383001  CDS       T02916                                 

Definition
Choline/ethanolamine kinase, putative
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CHC_T00008383001
Enzymes [BR:ccp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CHC_T00008383001
    2.7.1.82  ethanolamine kinase
     CHC_T00008383001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MSSLVEKKPRIPRFEYDINTEEEIPKLREVIPGWGTSSSEDSALIVEPIIGGITNRIYKL
SNPRQNPCSVLVRIFGGETIFTPSERQQENAVFEELGKIGVAPKLIALFGNGRVEAFLNS
RAIVLDEMVDPVVMTGVARAMAKLHKFEPSGGLELSRSPGVWADIDKWVPEVLNLREKNS
AFVEKLSVNLDKCVKGLQDIRKALAERQSSSPIVFCHNDLLCGNILRSLNQGTAVSIVDF
EYSSFNYRGFDIGNFFCEAMGGTQDGYIDASRYPSSSARRLFCRKYLEEFCGCQPEEYAV
SELVAEAEEYGMLAHLYWGFWGLVQSVTSPVDFPYALFADQRFTRFFEKYSP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccttggtcgagaaaaaaccccgcattccaaggtttgagtacgatatcaacacg
gaggaggaaatcccaaagctgcgcgaagtcataccgggctgggggacgtcatcatctgag
gatagtgcactcattgttgaaccgatcatagggggaattacaaatcgcatctacaaacta
tcgaacccgcgtcaaaacccctgctcagttctcgtgcggatcttcggaggagagaccatt
ttcacaccctccgagagacagcaagagaacgccgttttcgaagagctcgggaaaatcggt
gttgctcccaagttgatagcgctgttcggcaatgggcgtgttgaagcgtttcttaactca
cgagccattgtgttggacgaaatggtcgaccctgtggtcatgacaggtgtcgctcgtgcc
atggcgaagttgcataagttcgagccaagcggagggttggagttgagtcggtctccaggt
gtatgggcggacatagataagtgggtaccagaagtactgaatttgcgagagaaaaactca
gcatttgttgaaaagctatcagtgaacttggacaaatgcgtcaaggggctgcaagatatt
agaaaagctctggctgagaggcaatcatcgagcccgattgtattttgtcacaacgatttg
ctctgcggtaatattttaaggtccctgaaccaggggacagctgtgtcgatcgtcgatttt
gagtatagctccttcaactataggggctttgatattggaaactttttctgtgaggcgatg
gggggaacgcaagatggatatattgacgcctcaaggtatccatcgagtagtgcgcgacgc
ttgttctgcaggaagtatctggaggagttttgtgggtgtcagccggaggagtatgctgtt
tctgagctcgttgcggaggcagaggagtacggaatgttggcgcacttgtactggggcttt
tggggactcgtacagagcgttacttctcctgtcgactttccgtatgcgttgtttgctgat
caacgatttacacgctttttcgagaaatactcaccgtga

DBGET integrated database retrieval system