KEGG   Chondrus crispus (carragheen): CHC_T00008493001Help
Entry
CHC_T00008493001  CDS       T02916                                 

Definition
(RefSeq) Beta amylase, GH14, Bam1
Organism
ccp  Chondrus crispus (carragheen)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_14
Motif
Other DBs
NCBI-GeneID: 17325431
NCBI-ProteinID: XP_005717715
UniProt: R7QIE3
AA seq 394 aa AA seqDB search
MVDVWWGLCEPAPGVYTFDKYVALAKLCRAKGLKVQATLSMHACGGNVGDSINIPLPPWV
VAAADEHSFWFTDRARAVTKEYISFGADHAPVLPAGPRAATGDTRTPVQAYEMFARAFVD
AMREHALLGSVVTELQVGVGPCGELRYPGYPMDRWQFPGIGQFQCYDEYLLQDLRKCVQE
TGSAEVKGAAMPPEGTGGYNDTPRRTEFFRRGYKGEAGRFFLRWYSERMLRHGEDVLKAV
RGVVEGEDLVLAVKVSGVHWWKHSASRAAEATSGYMLGAGEPAYGEIARMLKRYDCVLDF
TCLEMRTIDQPWLRARCGPRQLVAEVFEAARKEGVRVAGENALERYDDVAYRQIVRAFRR
CRAQRYGFTLLRLGDTLMEEDNLKRLGEFVKEMS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgtgtggtggggtctgtgcgagcccgcgccgggcgtgtacaccttcgacaag
tacgtcgcgctcgccaaactctgccgcgcgaaggggctcaaagtccaggccacgctcagc
atgcacgcgtgcggcggcaacgtgggcgactcgatcaatatccccctcccgccctgggtc
gtcgccgccgccgacgagcactccttctggttcaccgaccgcgcgcgcgccgtcaccaag
gagtacatctcgttcggcgcggaccacgcccccgtcctgcccgcggggccgcgcgccgcc
acaggggacacacgcacccccgtgcaggcgtacgagatgttcgcgagggcgttcgtcgac
gccatgcgggagcacgccctgctgggcagcgtcgtcaccgagctgcaggtcggcgtcggg
ccgtgcggagagctgcggtacccaggctaccccatggatcggtggcagtttccgggcatt
ggccagtttcagtgctatgatgagtacttgctgcaggatctgaggaagtgcgtgcaggag
acggggagcgcggaggtgaagggcgccgcaatgccgccggaggggacgggcgggtataat
gacacgccgcggaggaccgagttctttaggagagggtacaagggggaggcggggcgcttc
tttttgaggtggtactcggagaggatgctgcggcatggggaggatgtgctgaaggcagtg
cgaggggtagtggagggggaggacctggtgctggcggtgaaggtgtcgggcgtgcattgg
tggaagcactccgcgtcgcgtgcggcggaggcgacgagcgggtacatgctgggggcgggg
gagccggcgtacggggagattgcgcggatgctgaagcggtacgactgcgtgctggacttc
acgtgcctggagatgcggacgatcgaccagccatggctgcgggcgcggtgcgggccgcgg
cagctggtggcggaggtgttcgaggcagcgcggaaggagggcgttcgggtggctggcgag
aacgcgctggagaggtatgacgacgtggcgtaccggcagatcgttagggcgtttcgtaga
tgtcgggcgcagaggtatgggttcacgctgctgcgactgggcgatacgctcatggaggag
gataacttgaagagactgggggaattcgtcaaggagatgagttga

DBGET integrated database retrieval system