KEGG   Chondrus crispus (carragheen): CHC_T00008493001Help
Entry
CHC_T00008493001  CDS       T02916                                 

Definition
Beta amylase, GH14, Bam1
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHC_T00008493001
Enzymes [BR:ccp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     CHC_T00008493001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 394 aa AA seqDB search
MVDVWWGLCEPAPGVYTFDKYVALAKLCRAKGLKVQATLSMHACGGNVGDSINIPLPPWV
VAAADEHSFWFTDRARAVTKEYISFGADHAPVLPAGPRAATGDTRTPVQAYEMFARAFVD
AMREHALLGSVVTELQVGVGPCGELRYPGYPMDRWQFPGIGQFQCYDEYLLQDLRKCVQE
TGSAEVKGAAMPPEGTGGYNDTPRRTEFFRRGYKGEAGRFFLRWYSERMLRHGEDVLKAV
RGVVEGEDLVLAVKVSGVHWWKHSASRAAEATSGYMLGAGEPAYGEIARMLKRYDCVLDF
TCLEMRTIDQPWLRARCGPRQLVAEVFEAARKEGVRVAGENALERYDDVAYRQIVRAFRR
CRAQRYGFTLLRLGDTLMEEDNLKRLGEFVKEMS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgtgtggtggggtctgtgcgagcccgcgccgggcgtgtacaccttcgacaag
tacgtcgcgctcgccaaactctgccgcgcgaaggggctcaaagtccaggccacgctcagc
atgcacgcgtgcggcggcaacgtgggcgactcgatcaatatccccctcccgccctgggtc
gtcgccgccgccgacgagcactccttctggttcaccgaccgcgcgcgcgccgtcaccaag
gagtacatctcgttcggcgcggaccacgcccccgtcctgcccgcggggccgcgcgccgcc
acaggggacacacgcacccccgtgcaggcgtacgagatgttcgcgagggcgttcgtcgac
gccatgcgggagcacgccctgctgggcagcgtcgtcaccgagctgcaggtcggcgtcggg
ccgtgcggagagctgcggtacccaggctaccccatggatcggtggcagtttccgggcatt
ggccagtttcagtgctatgatgagtacttgctgcaggatctgaggaagtgcgtgcaggag
acggggagcgcggaggtgaagggcgccgcaatgccgccggaggggacgggcgggtataat
gacacgccgcggaggaccgagttctttaggagagggtacaagggggaggcggggcgcttc
tttttgaggtggtactcggagaggatgctgcggcatggggaggatgtgctgaaggcagtg
cgaggggtagtggagggggaggacctggtgctggcggtgaaggtgtcgggcgtgcattgg
tggaagcactccgcgtcgcgtgcggcggaggcgacgagcgggtacatgctgggggcgggg
gagccggcgtacggggagattgcgcggatgctgaagcggtacgactgcgtgctggacttc
acgtgcctggagatgcggacgatcgaccagccatggctgcgggcgcggtgcgggccgcgg
cagctggtggcggaggtgttcgaggcagcgcggaaggagggcgttcgggtggctggcgag
aacgcgctggagaggtatgacgacgtggcgtaccggcagatcgttagggcgtttcgtaga
tgtcgggcgcagaggtatgggttcacgctgctgcgactgggcgatacgctcatggaggag
gataacttgaagagactgggggaattcgtcaaggagatgagttga

DBGET integrated database retrieval system