KEGG   Chondrus crispus (carragheen): CHC_T00008662001Help
Entry
CHC_T00008662001  CDS       T02916                                 

Definition
1,4-alpha-Glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ccp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 754 aa AA seqDB search
MGGAQENTDPHFQAWKDASDGTACIRDDRYLEPYADALRYRYAKYQEIRSAIDESEGGLD
NFSRGYENMGLTRVKGGVRYREWAPSAKEMYFFGEFNNWDRKACPMKRGEFGIWECFVKD
AEDGAMGIPHATKVKATVITHGGMSLDRNPAWAGYCVQDNSTFLYDAMFWHPKESYKWKS
EPHVKRPQSLRIYECHVGMGTNDLKVGTYREFADNVLPRIKETGYTALQIMAIMEHAYYA
SFGYHVTNFFAISSRSGAPEDLKYLIDKAHQLGLYVLMDIVHSHASSNSMDGINQFDGTD
HHYFHEGERGRHSLWDSRLFNYGHWEVLRFLLSNLRWYMEEYHFDGFRFDGVTSMLYLHS
GIGVQFSGDYGEYFGFQVDIDACVYMMLANELVHSLYPDVAVTVAEDVSGMPTLCVPVER
GGLGFDYRLAMAIPDMWIEIFEKEKDENWKMGNIVFTLTNRRWNEKTIGYCESHDQALVG
DKTMAFWLMDAAMYTDMSCDGYPSPAVERGVALHKMIRLLTMCLSGEGYLTFMGNEFGHP
EWIDFPREGNNNSYQHARRRWDLVDNKQLRYRHLYLFEQQMHALEEKHPFCRFQVHQYVV
LQHETDKVIVVERGDRLLFVFNFNHSQSFTDYRVGTYWGGRYRLVLDSDGSETGGHGRLD
RNVVHETRTESWQDRPNYLQVYAPARTCQVYHCYETWDEVSQDSGRVEPKQAAVTETPSS
GVTQVEVVASKLEATNINGAGNGAAPKPEAAGAK
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgcgcaggagaacacggacccgcacttccaggcgtggaaggacgcgtcggac
gggacggcctgcatccgcgacgaccgctatctcgagccgtacgcggacgccctacgctac
cgctatgctaagtatcaggagatccgctcggcgattgacgagtcggagggcggcctggac
aacttttcgcgcggctacgagaacatgggcctgacccgcgtcaagggcggcgtgcgctac
cgcgagtgggccccaagcgcaaaggagatgtacttcttcggcgagtttaacaactgggac
cgcaaggcttgccccatgaagagaggagagtttggcatttgggagtgctttgtgaaggat
gccgaagatggcgccatgggcattccgcatgctaccaaggtgaaggctactgttattacg
catgggggtatgtcgctggatcgtaacccggcctgggctggctactgtgtccaggataac
tcgaccttcttgtatgatgccatgttctggcatccgaaggagagttataagtggaagtct
gagccccatgtgaagcgtccgcagagtctcaggatctatgagtgccatgtgggtatgggg
accaacgatttgaaggtcggtacttaccgggagtttgcggataacgtactgcccaggatc
aaggagacaggctacaccgccctgcagatcatggccatcatggagcacgcctactacgcg
agctttggctaccatgtcacaaactttttcgccatctcgagcaggtcgggcgctccagag
gacttgaagtacttgattgataaggcccaccaactcggcttgtacgtcttgatggacatt
gtccactcgcatgcctcgtccaactccatggatggtatcaaccaatttgacggcaccgac
caccactacttccatgagggcgagagggggaggcattcactctgggattctaggttgttc
aactatggccactgggaggtcctccgctttttactctccaacctgcgctggtacatggag
gagtatcactttgacggcttccgttttgacggtgtcaccagtatgctctacttgcactcg
ggcatcggcgtccagttttcgggtgactatggagagtactttggcttccaggttgacatt
gacgcctgcgtgtacatgatgctcgccaacgagctcgtccactcgctctacccggatgtt
gccgttaccgttgctgaggatgtgagcggcatgcccacgctatgcgtccccgtcgagcgc
ggcgggctcggctttgactaccgcctcgccatggctattccggacatgtggattgagatt
ttcgaaaaggaaaaggacgaaaattggaagatgggcaacattgtcttcaccctcaccaat
cgaaggtggaatgagaagacgattggctactgcgagagccacgaccaggccctcgtgggg
gacaagaccatggcattttggttgatggatgccgccatgtacacagacatgagctgcgac
ggctacccatcgccggccgtggagaggggtgtggctttgcacaagatgatccgcttgctc
acgatgtgtctctcgggcgagggctatctcacttttatgggcaacgagtttggacacccc
gaatggatcgactttccgcgcgagggcaataataactcgtaccagcatgcgcgccgtcgg
tgggacttggtggataacaagcagctgagatatcggcatctgtatctgtttgagcagcaa
atgcacgcgctggaggagaaacacccgttctgccgcttccaggtgcaccagtacgtcgtt
ttgcagcacgagacggataaggtcattgttgtggagcggggcgaccgtctgctgtttgtt
ttcaacttcaatcattcgcagtcctttaccgactaccgcgtcgggacatactggggcggc
cgatatcggttagtactcgactcggacgggtctgaaactgggggccacgggcgcctcgat
cggaacgtggtccatgagacgcgaacagaatcgtggcaggatcgaccgaattatttgcaa
gtgtacgcgcccgccagaacatgccaggtgtaccattgctatgagacatgggacgaagtg
tcgcaggacagtggtcgggtagagcccaaacaggcagcggtgacagaaacgccgtcgtcg
ggtgtgacacaagtcgaagttgtggcgagcaaacttgaggctacaaacataaacggcgct
ggaaacggcgctgctccaaagcccgaggctgccggggcgaagtag

DBGET integrated database retrieval system