KEGG   Chondrus crispus (carragheen): CHC_T00008803001Help
Entry
CHC_T00008803001  CDS       T02916                                 

Definition
Ubiquitin carboxyl-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ccp  Chondrus crispus (carragheen)
Brite
Enzymes [BR:ccp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CHC_T00008803001
Peptidases [BR:ccp01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CHC_T00008803001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MGDSGWCTIESDPGVFTELLSSIGAKRVQVEELYSLDKTLIPQHGTVYGLVFLFKYQKRP
PAAERPGTLIYPPPDTLFFANQTIQNACATQAILSIIMNAPAVDVGEELQRFREFSAGMD
PVTKGMVVGNSEVIRTAHNSFAPQEQLVVDRDPNAEKEDPFHFVAYVPHNGKVYELDGLQ
KGPFELGEVPKEADWLDVATPVISKRMEEYQQAGDGTEIRFNLMMVVEDPREKLTRKIEE
LRKDGGDTGRKMDLEEKLAREEDKHKQWHKENVRRRFNFTPFIISFLKALATSGHAGAVI
KQVTEQKKTAYQERLEKEKEANTSQPN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattccggctggtgcacaatcgagtccgacccaggcgtcttcaccgagcttctg
tcctcgatcggcgccaaacgcgtccaagtcgaggagctctactccctggacaagaccctc
atcccccaacatgggaccgtctacggcctcgtattcctcttcaagtaccaaaaacgcccc
cccgcggccgaacgccctggcaccctaatctacccgccgccagacacgctcttcttcgcc
aaccagaccatccaaaacgcgtgcgcgacgcaggccatcctgtccatcattatgaacgcc
cccgctgttgacgtgggggaggagctccaacggtttcgcgaattctccgcgggcatggat
cctgtcaccaaaggcatggtcgtgggtaattccgaggtcattcgcacagcgcacaactcc
ttcgcgccgcaggaacagctcgtcgtagatcgtgatcccaatgcagagaaggaggacccg
tttcattttgttgcctacgttccgcacaatgggaaggtctatgagctggacggtctgcag
aaaggacccttcgagcttggtgaagtaccaaaggaggccgattggttggatgtggctacg
cctgtcatttcgaagaggatggaagagtaccagcaggcaggtgatggcaccgaaattcgg
ttcaacttgatgatggtcgtggaagatccgagggagaaactcacgcgtaagattgaggag
ctacgcaaggatggaggcgatacggggaggaaaatggatttagaggagaagcttgcgaga
gaagaggacaagcacaagcagtggcacaaagagaacgtgcgaagaaggttcaactttacg
ccgttcattatttcattcttgaaggcgttggcgacgtcagggcatgcgggggctgttatc
aagcaggtgacggaacagaagaagacagcgtatcaagaacggttggaaaaggaaaaagaa
gcgaatacgtctcaaccaaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system