KEGG   Chondrus crispus (carragheen): CHC_T00009268001Help
Entry
CHC_T00009268001  CDS       T02916                                 

Definition
Dolichyl-phosphate-mannose--protein mannosyltransferase, family GT39
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CHC_T00009268001
Enzymes [BR:ccp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CHC_T00009268001
Glycosyltransferases [BR:ccp01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CHC_T00009268001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 593 aa AA seqDB search
MYSTFADLPSYHIFIYNRAKTRAYSGVQRNVLYGTVSTFYLTGSRCSIYSRGDAFFRPSS
QIHQRHIGLFFVQTRSFLPASEVHTVMAVQAKKPASLAQAPAAERHVSFSEPDTSIAIPP
RSHPGDNRDRVLCWILFTISSCVRFYRLGMPASVVFDEYHFGSFVDNILSGATHFDIHPP
LGKLTLAVFGYLVGYRPDPKFGYDSIGKEFGGVLYYPLREIAAIFGVVTVPLMYSTARNL
DVSWVGSLLVAGLFCFDNLNIIESRLILMDSQIVFYLVLSLFCALHLWRSPPKTWRRFWW
LTATGLVCGCSISVKWTALATPGLIAIVSFFGLHFLEDPLTLLECIWAGIMGLGLYTALF
WVHFKTLTHTGPGVGFFPAEFRKTLIGEPDYDPTAVRKPFFELFVYLNKYMFTANAGITT
RHNWESYWYQWVVNWRGLLYSNTPIGDKWASVYLFANPIICWVCAAFVGLFIVIFLFSIR
YRDAKWLKALRKESFLYARRTSTFLFWGWLINLLPYILVDRSAFVYHYLPGLIYAQLLSG
VMVDQLPMKLRVFSVLVLMSVSIACFVYYAPWIYCTPLTSEEHSARRWLRRWD
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtacattcgctgacctaccgtcgtatcatatctttatttacaacagagctaaa
acccgagcatacagtggtgttcaacgcaatgtactgtacggcacagtcagtaccttctac
ctgacaggatcaaggtgttcaatctactctagaggagacgcattctttcgcccttcgtca
cagatacaccaacgacacattggcctattctttgtgcaaactcggtcattcttgcctgca
tcagaagtgcacacagtcatggctgtacaagcaaagaagccggcatcgctagctcaagcg
ccagccgcggaacgacacgtctccttcagcgaaccggacacatccattgccattccgccc
cgttctcatcccggtgacaatcgcgacagagtcttatgctggattctcttcacgatctcc
tcatgtgttcgattctaccgtctcggtatgccagcctcagtggttttcgacgaataccac
tttggatcgtttgtcgataacatcctctccggagcaactcactttgatattcatcctccc
ctaggaaagctcactttggccgtcttcggatatctggtaggctatcgtcccgatcccaaa
tttggatacgattcaattggcaaggaatttggcggcgtcctgtactatccattgcgtgag
atcgccgccatttttggagttgtcacagtcccgctcatgtattccacagctcgaaattta
gacgtctcgtgggtcggttcccttctcgtagcaggtctgttctgcttcgataatctcaac
attatcgaaagccgtctcatactgatggattctcagattgtcttctatctcgtcctgtcc
ttattttgtgctctccatctctggcgctcaccacccaaaacatggagacgcttttggtgg
ctcacggccaccggactcgtttgcggatgttcaatcagtgtcaaatggaccgcccttgca
acaccggggctcattgcgatcgtctcttttttcggtcttcatttcttggaagatccgctc
accttgcttgagtgcatctgggcaggcatcatgggtcttggtctgtacactgcgcttttc
tgggtccatttcaagaccttgacccacacagggccaggagttgggttctttcctgcggaa
ttccggaaaacgctaatcggcgagcctgactatgatccgactgccgtgagaaagcccttc
ttcgagctctttgtatacttgaataagtacatgttcactgcaaacgccggaatcactacg
cgccataactgggagagctactggtatcaatgggtcgtcaactggagaggccttttatac
tcgaatacaccaattggagacaaatgggcctccgtgtatttgttcgcgaacccaattatt
tgttgggtttgcgcagcctttgtcggtcttttcatagttatattcctcttctccattcgc
tatcgggatgcaaagtggttaaaggctctaaggaaagagtcatttttgtatgcacggagg
acaagcacattcttgttttggggctggcttatcaacttgctcccgtacatcctagttgat
cgctcagcgtttgtatatcattacttgccagggcttatctatgcgcaattgttgtcagga
gtcatggtcgaccaactaccgatgaagcttcgcgttttttctgtgcttgtcctcatgtct
gtatccattgcatgctttgtgtactacgcaccctggatttattgcaccccactaacgagt
gaagaacactccgctcgcagatggctgcggagatgggactga

DBGET integrated database retrieval system