KEGG   Chondrus crispus (carragheen): CHC_T00009270001Help
Entry
CHC_T00009270001  CDS       T02916                                 

Definition
probable histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ccp  Chondrus crispus (carragheen)
Brite
Enzymes [BR:ccp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHC_T00009270001
Transcription machinery [BR:ccp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CHC_T00009270001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 394 aa AA seqDB search
MPIVPVPPCKKPRQPPSNAAIHPTEDILGWDSQHAYIQRWVRMTQEEKNNNVKFQVVQND
SKRDSLLLLLGLKNVFVKQLPNMPRPYVSRLVFDRKHESLALLRRKDNDYTVMGGCCYRP
FPDQKFGEIAFLAISQNVQVQGYGTRLMAQTKERAKSIGLTHLLTCADNNAVAYFKKQGF
SKKITLPFEKWQGYIKDYDGVTLMECVLHAKVDYLNIPMLLKAQKTAMVEKLKEISNSHI
VFPGIDVTSRKGLKIEDIPGLKEIGWKKDKNGAFSTRGGPTAGFSVRDKASQELLHKHLQ
SVLKEIKSHDCSWPFLEPVNAQETGAIDYYEVIKNPMDLKTMHDRLEEGWFYVTKEIFIA
DMKRMVENCKKYNGKGHYVTDLAIQLEKAFMSKI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgtccctgtcccgccatgtaagaaaccacgtcaacctccaagcaatgccgct
attcaccccacagaggatattctcggttgggattctcaacatgcctatattcaaagatgg
gtccgcatgacgcaagaagagaagaacaacaatgtcaagtttcaagttgttcaaaacgat
tccaagcgcgacagccttctcctgttgttgggcctcaaaaacgttttcgtcaagcagctg
cccaacatgccgcgtccatacgtatctcgcttggtttttgatcgaaaacatgaatccttg
gcgctattgagaagaaaggacaatgattatactgttatgggggggtgctgctaccggcct
tttccggatcagaaatttggcgagatcgcgtttttggcgatttctcaaaacgtgcaagtc
caaggatatggtacccgattgatggcacaaacgaaggagagagcaaagagcattggtctc
acccatctgctcacatgtgcggataacaatgcggtcgcttattttaaaaaacaagggttc
agtaagaaaatcactttacccttcgagaaatggcaaggctatatcaaggactatgatgga
gtcacgctgatggagtgtgtcttgcacgctaaggtggattatttgaacattcccatgttg
ttgaaagcgcagaagacagccatggttgagaaattgaaagagatttccaattcgcacatt
gtgtttcctggaattgacgtaacgtcaaggaaaggactgaaaattgaggatataccaggg
ttgaaggaaattgggtggaaaaaggacaagaatggggcgttttcaacgagaggaggtccg
accgccgggttttcagtgcgcgacaaggcatctcaggaactgttgcataagcacttgcag
tccgtgctgaaggaaataaaatcacacgactgttcgtggccctttttagaacctgtgaat
gcacaggagactggtgccatcgactactatgaggtcattaagaacccaatggacttaaaa
acgatgcacgacagactcgaggaaggatggttctatgtaacaaaagaaatcttcatcgcg
gacatgaagcggatggtagagaattgcaagaagtacaacgggaaagggcactacgtcact
gacctagcaattcaactggaaaaggcattcatgagcaaaatatag

DBGET integrated database retrieval system