KEGG   Chondrus crispus (carragheen): CHC_T00009557001Help
Entry
CHC_T00009557001  CDS       T02916                                 

Definition
stearoyl-CoA desaturase Delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ccp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ccp01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 345 aa AA seqDB search
XXYILTGTGITAGYHRLYSHKAYAASFPVEFVMLAWGAAAFEGSARWWSRNHRAHHRYVD
TEKDPYSVHKGFWYAHIGWMILKQDSRRAGRVDISDLNAHRGVMFQHKNYLPIALFFGFV
FPLAVATMGWGDFWGALVYACFGRMFFVHQATFCVNSLAHTFGVQTYSKEHTSYDHIITA
LVTFGEGYHNYHHEFPHDYRNGIRWYHYDPTKWMVRALSWFGLCSRLIRFPNNEIRKAEL
QVRQQDLDELKKTIDWGQDIATLSTMNWDTVNARVAEGEKLVIIDGIVHKIDDFVSMHPG
GSKILGFWNGRDATIAFHGEVYKHSKGARNLLAHFRVAKLHEDLE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
nnnnaatacatcctcactggcacgggcattaccgctggctaccaccgcctctacagccac
aaggcctacgccgcttcgttccccgtcgagtttgtcatgctcgcctggggcgccgccgca
tttgaaggcagcgcccgctggtggagccggaatcatcgcgcgcatcaccgctatgtcgat
acggagaaggacccgtactccgtccacaagggcttttggtacgcgcacattggctggatg
atcttgaagcaggactcgagaagggctggcagagtcgatattagcgacttgaacgctcat
cggggcgtcatgttccagcacaaaaactacttgcccattgctcttttctttggctttgtc
ttcccgcttgccgtcgctaccatgggatggggcgatttctggggggccttggtctatgcc
tgctttggccgcatgttctttgtacaccaggctaccttttgcgtcaacagtttggcgcac
acctttggcgtccagacatactcgaaggagcacactagctacgatcatatcattactgcc
cttgttaccttcggcgagggataccacaactatcatcatgaatttccgcatgactatcgc
aacggcatccgttggtatcactatgatcccaccaagtggatggtcagagccttatcctgg
tttggcctatgctcacgtctcatccgcttcccaaacaacgagattcgcaaagccgagtta
caggtccgccaacaggacctcgacgaactcaagaagactatcgactgggggcaggacatt
gccactctttctactatgaactgggatacggtcaacgcccgcgtcgccgagggtgaaaag
ctcgtcatcatcgacggcatcgtccacaagattgacgactttgtctcgatgcatcctgga
ggctcaaagattctcggcttttggaacgggcgcgatgctaccatcgcattccatggggag
gtgtacaaacactctaagggagcgcgtaacttgttggcacacttcagagtcgccaagttg
catgaagatttagaatag

DBGET integrated database retrieval system