KEGG   Chondrus crispus (carragheen): CHC_T00009557001Help
Entry
CHC_T00009557001  CDS       T02916                                 

Definition
stearoyl-CoA desaturase Delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CHC_T00009557001
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CHC_T00009557001
Enzymes [BR:ccp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CHC_T00009557001
Lipid biosynthesis proteins [BR:ccp01004]
 Desaturase
  First
   CHC_T00009557001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 345 aa AA seqDB search
XXYILTGTGITAGYHRLYSHKAYAASFPVEFVMLAWGAAAFEGSARWWSRNHRAHHRYVD
TEKDPYSVHKGFWYAHIGWMILKQDSRRAGRVDISDLNAHRGVMFQHKNYLPIALFFGFV
FPLAVATMGWGDFWGALVYACFGRMFFVHQATFCVNSLAHTFGVQTYSKEHTSYDHIITA
LVTFGEGYHNYHHEFPHDYRNGIRWYHYDPTKWMVRALSWFGLCSRLIRFPNNEIRKAEL
QVRQQDLDELKKTIDWGQDIATLSTMNWDTVNARVAEGEKLVIIDGIVHKIDDFVSMHPG
GSKILGFWNGRDATIAFHGEVYKHSKGARNLLAHFRVAKLHEDLE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
nnnnaatacatcctcactggcacgggcattaccgctggctaccaccgcctctacagccac
aaggcctacgccgcttcgttccccgtcgagtttgtcatgctcgcctggggcgccgccgca
tttgaaggcagcgcccgctggtggagccggaatcatcgcgcgcatcaccgctatgtcgat
acggagaaggacccgtactccgtccacaagggcttttggtacgcgcacattggctggatg
atcttgaagcaggactcgagaagggctggcagagtcgatattagcgacttgaacgctcat
cggggcgtcatgttccagcacaaaaactacttgcccattgctcttttctttggctttgtc
ttcccgcttgccgtcgctaccatgggatggggcgatttctggggggccttggtctatgcc
tgctttggccgcatgttctttgtacaccaggctaccttttgcgtcaacagtttggcgcac
acctttggcgtccagacatactcgaaggagcacactagctacgatcatatcattactgcc
cttgttaccttcggcgagggataccacaactatcatcatgaatttccgcatgactatcgc
aacggcatccgttggtatcactatgatcccaccaagtggatggtcagagccttatcctgg
tttggcctatgctcacgtctcatccgcttcccaaacaacgagattcgcaaagccgagtta
caggtccgccaacaggacctcgacgaactcaagaagactatcgactgggggcaggacatt
gccactctttctactatgaactgggatacggtcaacgcccgcgtcgccgagggtgaaaag
ctcgtcatcatcgacggcatcgtccacaagattgacgactttgtctcgatgcatcctgga
ggctcaaagattctcggcttttggaacgggcgcgatgctaccatcgcattccatggggag
gtgtacaaacactctaagggagcgcgtaacttgttggcacacttcagagtcgccaagttg
catgaagatttagaatag

DBGET integrated database retrieval system