KEGG   Chondrus crispus (carragheen): CHC_T00009566001Help
Entry
CHC_T00009566001  CDS       T02916                                 

Definition
elongator protein Elp3p
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ccp  Chondrus crispus (carragheen)
Brite
Enzymes [BR:ccp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHC_T00009566001
Transfer RNA biogenesis [BR:ccp03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CHC_T00009566001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 597 aa AA seqDB search
MARGDAVCACAAGAESGTSCVCASEKTGRITPAPRRPRRAADQALAKKAAIAEIVSSLIR
LHATPNAASVTSIKTAAAKRHGLADYPKQVDILAAPVRTASGIAVVAVMSKPHRCPHIAT
TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYVQVRSRVDQLRALGHDVDK
VEFILMGGTFMSLDNTYRDYFIRNLHDALSGHSSQSVKEAVRYSEHSHAKCVALTIESRP
DHSSPHHLSAMLEYGCTRLEIGVQSVYEDVARDTNRGHSVQAVSDCFRLAKDAGFKVVSH
MMPDLPNMGKERDMESFRELFDNPAFRPDGLKIYPTLVIRGTGLYELWKNGLYKNYAPPD
LIDLIARILALVPPWVRVYRIQRDIPMPLVSSGVEHGNLRELSLARMHDLGLPCRDVRTR
EVGIQTIHFQINPEQVELVRRDYVANGGWETFLSYEDAAQDILVALLRLRQAGPGAGAVR
PEMAGEECSIVRELHVYGSVVPVHERDPGKFQHRGFGTLLMEEAERIAAEEHGSTKVVVI
SGVGTRHYYRKLGYVLQGPYMVKNVLLFNLFSLDLCLLNKKEKDTLATAGDLCDAEG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaggggacgcggtctgcgcctgcgcggccggcgcagaaagcggcacatcctgt
gtatgcgcctcagagaaaacggggcgcattactccggcgccgcgccgcccgcgccgtgct
gcggaccaagcccttgccaagaaagccgccatcgctgagatcgtctcttctctcatccgt
ctgcacgccacgccaaacgccgcctccgtcacatccatcaagacggccgcggcgaagcgc
cacggcctggccgactacccgaagcaggtcgacatcctcgccgcccccgtgcgcacggcg
agcggcatcgctgtcgttgccgtcatgtccaagccgcatcgctgcccgcatatcgctacc
accggaaacatttgcgtctactgccccggaggtccggattctgactttgagtactccact
caaagttacacaggatatgagcccacttctatgcgcgccattagggcccgatacgatcct
tatgtccaggttaggtcaagggttgatcagctgcgtgcgctggggcatgatgtagacaaa
gtcgagtttattctcatggggggcactttcatgtcgttggataatacctaccgcgactac
tttataagaaacttgcatgatgctctcagtgggcattcatcgcagtctgtcaaagaggct
gtcaggtactcggaacactcgcatgccaagtgcgtcgccctgacaattgaaagccgcccg
gaccactcctccccgcaccacttgtcggctatgttagagtacggctgtactagattggag
attggcgtccagagtgtctatgaggacgtcgcgagggatacgaacagagggcattcggtg
caagcagtgagtgactgcttccgtctcgcaaaggatgcaggctttaaggttgtttcacat
atgatgccggatcttccaaatatggggaaggaaagggacatggagtcgttcagagagctt
ttcgacaacccagctttccgtccagacgggctaaagatatatcctacgctcgtcattcgc
ggcactggactttacgaattgtggaagaacggtctttacaagaattacgctccgccagac
ctcatcgaccttatcgcacgaatcctcgcgctagtgccaccgtgggtgcgcgtgtacaga
atacaaagagacatccccatgccgttagtttcatccggggtggaacacggaaacttgcgt
gagctttcactggcacgcatgcacgacctcggtctgccctgtcgcgatgtgcgcacacgt
gaagtgggaatccaaacaattcatttccagattaaccccgagcaggtcgaactcgtgcgc
agagattacgttgcaaatggggggtgggagaccttcctttcatatgaggatgcggctcag
gatattcttgtcgctcttctgcggttgcggcaggctgggccgggtgccggtgcagtcaga
cctgaaatggcaggtgaggaatgcagcattgtccgcgagttgcatgtatatggatccgtt
gtgccggtgcatgagcgggaccccggaaagtttcaacatcgcggctttggtaccttgctg
atggaagaagcagagagaatagccgcagaggagcatgggtcaacgaaagttgtcgttata
tctggagttggaacgcgccattattacagaaagctcggatatgttcttcaaggaccgtac
atggtgaagaacgttctacttttcaacttattttctctcgacttgtgcttgctcaacaag
aaggaaaaagatactctcgccacagcaggtgacttatgcgatgcggaaggatag

DBGET integrated database retrieval system