KEGG   Caulobacter crescentus CB15: CC_0008Help
Entry
CC_0008           CDS       T00049                                 

Definition
chromosome replication initiator DnaA
Orthology
K02313  
chromosomal replication initiator protein
Organism
ccr  Caulobacter crescentus CB15
Pathway
Two-component system
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_0008
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_0008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5636..7108
Genome map
AA seq 490 aa AA seqDB search
MTMKGGVASQDFSAAIATACEPAANVWSKVCVALKRELGDAAFGSWIAPAMLREAATGDV
VLVTSTGIARDWIRRSAWRRIGELWAAHDATGRRIDLKSRLEFEAAAGAYVEATPKAVAA
EPIEIVLPVSTDAPTVVAPSAKSPRTQGLQERFTFETFVPGPANEFAHAVARRIANWADG
HFNPVLFHGPYGFGKTHLLNALAWEAMRNAPEKRVVYLTAERFLSTFVRAVMDRQTAAFK
EELRAADLLIIDDVHFIAGKQSTQEELFHTLTALVGEGGRVVFSADRPPSAMTEMDAHLR
SHLSAGLVCGLEPADRNLRLGILERKIQTLGAAHGFEPSIRPEVMQFLADRFTDSVRELE
GALNTLSARAGEGLSRMTLDEVQAILRPHLRSGEKRITIDDIQKATAEHYGMKQADLLSE
RRNRAVARPRQAAMWLAKQLTTRSLPDIGRRFGGRDHTTVLHAVRRIEALRAEDSALSHD
LETLTRKLRG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaagggcggggttgccagccaggacttctcggcggcgatcgcgacggcttgt
gagccggcggcgaacgtctggtcgaaggtttgcgtggctttgaagcgtgagctgggtgac
gcggccttcgggtcgtggatcgcgcccgccatgctgcgcgaagccgccactggcgatgtc
gtcctggtgacgtcgacgggcatcgcccgcgactggattcgccgcagcgcctggcgccgg
atcggcgaactctgggccgcccatgatgcgacaggtcgtcgcatcgacctgaagtcgcgc
ctcgagttcgaagcggcggccggcgcctatgtagaggcgacccccaaggctgtcgccgcc
gaaccgatcgagattgtcctgcccgtctccactgacgcgccgacggtcgtcgcgcccagc
gccaagtcgccccgcacccaaggcttgcaggagcgcttcaccttcgagaccttcgtcccg
ggtcccgccaacgagttcgcgcacgctgtagcgcgtcggatcgccaactgggcggacggt
cacttcaatcctgtgctgttccacggcccgtacggttttggcaaaacgcacttgctgaac
gccctggcctgggaggccatgcgcaacgccccggaaaagcgcgtggtctatctgaccgcc
gagcgcttcctgtcgaccttcgtgcgcgccgtgatggatcgtcagaccgcggccttcaag
gaagagctgcgcgccgctgatcttctgatcatcgacgacgtgcacttcatcgccggcaag
cagtcgacccaggaagagctgttccacaccctgaccgcgctggtcggggagggcggccgt
gtcgtgttctcagccgaccgtccgccgtcggccatgaccgagatggacgcccatctgcgc
tcgcatctgtcggcgggtctggtctgcggtctcgagccggcggatcgcaacctccgtctc
ggcatcctggagcgcaagatccagaccctgggcgcggcccacggctttgagcccagcata
cgccccgaggtcatgcagttcctcgccgaccgtttcaccgacagcgtccgcgagctggaa
ggcgcgctgaacaccttgtcggcccgcgccggcgaaggcctctcgcgcatgaccctggat
gaggtgcaggcgatcctgcgtccccacctgcggtcgggcgagaagcgcatcaccatcgac
gatattcagaaggccaccgccgagcattacggcatgaagcaggccgatctgcttagcgaa
cgccgcaaccgcgccgtggcccggccgcgtcaggccgccatgtggctggccaagcagctg
accacccgttcgctgccggacatcggccgtcgcttcggtggtcgcgatcacaccacggtc
ctgcacgccgtccgtcggatcgaggccttgcgcgctgaggacagcgccttgagccacgat
ctggagaccctgacgcgcaagctgcggggctaa

DBGET integrated database retrieval system