KEGG   Caulobacter crescentus CB15: CC_0269Help
Entry
CC_0269           CDS       T00049                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ccr  Caulobacter crescentus CB15
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CC_0269
DNA repair and recombination proteins [BR:ccr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CC_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284702..285160
Genome map
AA seq 152 aa AA seqDB search
MAEAQAKVRTCGTCGSLDVTDPCAVCADGSRDGRLLCVVEEVGSVWAMERGGSFKGRYHV
LGGLLSALDGIGPEALRIGELVGRVADGSVAEVILALPATVDGQTTAHYIADRLAKTNVP
VTMLARGVPVGGDLDWLDDGTIAQALRARRPA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcgcaggccaaggttcgcacctgcgggacctgcggctcgctggacgtcacc
gatccctgcgccgtctgcgcggacggctcccgcgatggccgcctgctgtgcgtggtcgag
gaggtgggctcggtctgggccatggagcgcggcggctcgttcaagggccgctatcacgtg
ctgggcgggctgctgtcggcgctggacgggattggacccgaggccttgcggatcggcgag
ctggtcggccgggttgcggacggatccgtcgccgaggtgatcctggccctgcccgccacg
gtcgatggccagacgaccgcccactacatcgccgaccgtctggccaagaccaatgtgccg
gtgactatgttggcgcgcggcgtgccggtgggcggcgacctcgattggctggacgacggc
acgatcgcccaggcgctgcgggcacggcggccggcttga

DBGET integrated database retrieval system