KEGG   Caulobacter crescentus CB15: CC_0269Help
Entry
CC_0269           CDS       T00049                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ccr  Caulobacter crescentus CB15
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ccr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
284702..285160
Genome map
AA seq 152 aa AA seqDB search
MAEAQAKVRTCGTCGSLDVTDPCAVCADGSRDGRLLCVVEEVGSVWAMERGGSFKGRYHV
LGGLLSALDGIGPEALRIGELVGRVADGSVAEVILALPATVDGQTTAHYIADRLAKTNVP
VTMLARGVPVGGDLDWLDDGTIAQALRARRPA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcgcaggccaaggttcgcacctgcgggacctgcggctcgctggacgtcacc
gatccctgcgccgtctgcgcggacggctcccgcgatggccgcctgctgtgcgtggtcgag
gaggtgggctcggtctgggccatggagcgcggcggctcgttcaagggccgctatcacgtg
ctgggcgggctgctgtcggcgctggacgggattggacccgaggccttgcggatcggcgag
ctggtcggccgggttgcggacggatccgtcgccgaggtgatcctggccctgcccgccacg
gtcgatggccagacgaccgcccactacatcgccgaccgtctggccaagaccaatgtgccg
gtgactatgttggcgcgcggcgtgccggtgggcggcgacctcgattggctggacgacggc
acgatcgcccaggcgctgcgggcacggcggccggcttga

DBGET integrated database retrieval system