KEGG   Caulobacter crescentus CB15: CC_0275Help
Entry
CC_0275           CDS       T00049                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CC_0275
  Amino acid metabolism
   00300 Lysine biosynthesis
    CC_0275
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CC_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
290161..291321
Genome map
AA seq 386 aa AA seqDB search
MTSPAPVSVSIDPVELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMKFGEIENLY
ARRGTARPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKEGVLYGRGAVDMKSAIAAFVAAV
ANVPDHPGSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANLLGDMVKI
GRRGSINAWITVEGRQGHVAYPHRAANPVPVLVDILSALKARVLDDGYTGFQPSNLEITT
IDVGNTATNVIPAAAKARVNIRFNPAHKGKDLAAWIEGECAKAAEGFDGAATALCKISGE
AFLTEPGDFTDVIVAAVTDATGRAPELSTTGGTSDARFIRALCPVVEFGLVGSTMHQVDE
RVPVEEVRQLAGAYEALIRRYFAAFA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccccgcgcccgtttccgtcagcatcgatcccgttgagctcgctcaagccctg
atccggcgtccgtcggtgacgccggccgacgccggcgcgatggacacgctgcagcgccaa
ctggaggcgctcgggttcgcctgccgccggatgaagttcggcgagatcgagaacctctac
gcccggcgcgggacggcgcggccgaacctctgtttcgccggccataccgatgtggtgccg
gtgggcgatgacgcggcctggaccgctgggccgttcgaggccgagatcaaggagggcgtg
ctctatgggcgcggcgcggtcgacatgaagtcggccatcgccgccttcgtcgccgccgtg
gcgaacgtccccgaccatcccggctcgatcagcttcctgatcaccggcgacgaggaagga
gtggccgaggacggcacggtcaaggtcgtcgaggccctggccgccgagggcgagatcatc
gaccactgcatcgtcggcgagccgacctcggcgaacctcttgggcgacatggtcaagatc
ggccggcgcggcagcatcaacgcctggatcaccgtcgagggccgccagggccacgtggcc
tatccgcatcgcgcggccaatccggttccggtgctggtcgacatcctgtcggccctgaag
gcgcgggtgctggacgacggctataccggcttccagccgtcgaacctggagatcaccacg
atcgacgtcggcaacaccgccaccaacgtcatccccgccgccgccaaggcgcgcgtgaac
atccgcttcaacccggcccacaagggcaaggacctggccgcctggatcgagggcgagtgc
gccaaggctgcggaaggtttcgacggcgcagccaccgcgctgtgcaagatcagcggcgag
gcgttcttgaccgagccgggcgacttcaccgacgtgatcgtggcggccgtcaccgacgcc
accggccgcgcgccggagctgtcgactaccggcggcaccagcgacgcccgcttcattcgc
gccctgtgccccgtcgtcgagttcggcctggtcggctcgaccatgcaccaggtcgatgag
cgggtcccggtcgaggaggttcgccagctggcgggcgcctatgaggcgctgatccgccgc
tacttcgcagcattcgcctaa

DBGET integrated database retrieval system