KEGG   Caulobacter crescentus CB15: CC_0276Help
Entry
CC_0276           CDS       T00049                                 

Definition
(RefSeq) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00220  Arginine biosynthesis
ccr00250  Alanine, aspartate and glutamate metabolism
ccr00471  D-Glutamine and D-glutamate metabolism
ccr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CC_0276
   00220 Arginine biosynthesis
    CC_0276
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CC_0276
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CC_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 942381
NCBI-ProteinID: NP_419095
UniProt: Q9ABF2
Position
291339..292259
Genome map
AA seq 306 aa AA seqDB search
MKALSIPDVLAEVAVLVRPHFGKGKPADYIPQLATVPGGKFGMAVRMVDGDEHVIGDADE
GFSVQSITKVFALGLALNRLGDEIWTRVGKEPSGTPFNHLSLLEAEQGVPRNPFINAGAL
AVTDVLMDVTRDPAALVRDFGGFLCGERLEIDPAVATSELAHAWQNRAIASLMRAKGTIT
HDPEAVVAAYCRQCALSMSCRQLARAFLPLAAGGFSPIAQETVFPERLTRRLNALLLTCG
IYDSVGSFAYRVGLPAKSGVGGGIVAVVPGKATVAVWSPELDRFGTSVVGTAALEAFSQI
TNCSVL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctctcgatccccgatgtgctggccgaggtggcggtgctggtcaggccgcac
ttcggcaaaggcaagcccgccgactacatcccgcaactggccaccgtgcccggcggcaag
ttcggcatggccgtgcgcatggtcgatggcgatgagcatgtcattggcgacgccgatgag
ggcttttcggtccagagcatcaccaaggtcttcgccctgggcctggccctgaaccggctg
ggcgatgagatctggacccgggtgggcaaggagccctcgggcacgccgttcaaccacctg
tccctgctggaagccgagcagggcgtgccgcgcaacccgttcatcaacgccggcgccctg
gcggtgaccgacgtgctgatggacgtcacgcgcgacccggcggccctggtccgcgacttt
ggcggcttcctgtgcggggagcgtttggagatcgacccggcggtggcgacctcggagctg
gcccatgcctggcagaaccgcgccatcgccagcctgatgcgcgccaagggcaccatcacc
cacgacccggaggcggtggtggccgcctattgccgccagtgcgccctctccatgagctgc
cgccagctggcgcgcgccttcctgccgctggcggccggcggcttttcgccgatcgcgcag
gagacggtgttccccgagcgcctgacgcggcgcctcaacgccctgctgctgacctgcggc
atctatgacagcgtcggcagcttcgcctatcgcgtggggttgccggccaagagcggggtg
ggcggggggatcgtagcggtggtcccgggtaaggcgacggtggcggtgtggtcgccggag
cttgaccggttcggcacgtccgtcgtcggaaccgccgccctggaagcgttcagccagatc
accaactgttcggtattgtag

DBGET integrated database retrieval system