KEGG   Caulobacter crescentus CB15: CC_0378Help
Entry
CC_0378           CDS       T00049                                 

Definition
modification methylase CcrMI
Orthology
K13581  
modification methylase [EC:2.1.1.72]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_0378
Enzymes [BR:ccr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     CC_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(398637..399713)
Genome map
AA seq 358 aa AA seqDB search
MKFGPETIIHGDCIEQMNALPEKSVDLIFADPPYNLQLGGDLLRPDNSKVDAVDDHWDQF
ESFAAYDKFTREWLKAARRVLKDDGAIWVIGSYHNIFRVGVAVQDLGFWILNDIVWRKSN
PMPNFKGTRFANAHETLIWASKSQNAKRYTFNYDALKMANDEVQMRSDWTIPLCTGEERI
KGADGQKAHPTQKPEALLYRVILSTTKPGDVILDPFFGVGTTGAAAKRLGRKFIGIEREA
EYLEHAKARIAKVVPIAPEDLDVMGSKRAEPRVPFGTIVEAGLLSPGDTLYCSKGTHVAK
VRPDGSITVGDLSGSIHKIGALVQSAPACNGWTYWHFKTDAGLAPIDVLRAQVRAGMN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgggccggaaaccatcatccacggcgactgcatcgagcagatgaacgccctg
cccgagaagtcggtcgacctgatcttcgccgatccgccctataatctgcagctgggcggg
gacctcctgcgtcccgacaattccaaggtcgacgcggtcgacgaccactgggaccagttc
gaaagcttcgccgcctacgacaagttcacccgcgagtggctgaaggccgcccgtcgcgtt
ctgaaggacgacggcgcgatctgggtgatcggcagctatcacaacatcttccgcgtcggc
gtggcggtgcaggacctgggcttctggatcctcaacgacatcgtctggcgcaagtccaac
ccgatgcccaacttcaagggcacccgcttcgccaacgcccacgagaccctgatctgggcc
tccaagagccagaacgccaagcgctacaccttcaactacgacgccctgaagatggccaat
gacgaggtgcagatgcgctcggactggaccatcccgctgtgcaccggcgaggagcgcatc
aagggcgccgacggccagaaagcccacccgacccagaagcccgaggccctgctctaccgc
gtcatcctgtcgacgacgaagccgggcgacgtgatcctggatccgttcttcggcgtcggc
accaccggcgcggccgccaagcgcctaggccgtaagttcatcggcatcgagcgcgaggcc
gaatacctcgagcacgccaaggcccgcatcgccaaggtcgtgccgatcgcgcccgaagac
ctggacgtcatgggctccaagcgcgccgagccgcgcgtgccgttcggcaccatcgtcgag
gccggcctactgtcgccgggcgacacgctttactgcagcaagggcacgcacgtggccaag
gtccgtccggacggctcgatcacggtcggcgacctctcgggctcgatccacaagatcggg
gctctcgttcagagcgcgccggcctgcaacggctggacctactggcacttcaagaccgac
gcgggtctggcgccgattgatgtgctgcgagcgcaggtgcgggcggggatgaactga

DBGET integrated database retrieval system