KEGG   Caulobacter crescentus CB15: CC_0436Help
Entry
CC_0436           CDS       T00049                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_0436
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CC_0436
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CC_0436
Two-component system [BR:ccr02022]
 CheA family
  CheA-CheYBV
   CC_0436
Bacterial motility proteins [BR:ccr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CC_0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
451877..452911
Genome map
AA seq 344 aa AA seqDB search
MAKIRVLVVDDSATMRSLISAALNRDPDIEVVGGAGDPFEARGMIKALNPDVVTLDIEMP
NMNGIDFLEKIMRLRPMPVVMVSTLTQAGAEMTLRALELGAVDCVGKPADATGTQEALAE
IVAKVKIAARASVRTNAGAAPTSAPTRRKDFMPSGDIVAIGSSTGGVEALLSILQLFPET
CPPTVITQHMPATFTASFAARLDRSSGAKVQEASDGALLEPGKVYVAPGGATHLEVVRSA
GLRCRLVAGDPVSGHRPSVDVLFNSVAHAVGDKAVGVILTGMGRDGAQGLLTMRKAGAKT
LGQDEASCVVYGMPRSAFEIGAVERQVSLSSMGQSILDLASARR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaagattcgcgttcttgtcgtcgacgactccgccacgatgcggagcctgatctcg
gcggccctcaaccgtgacccggacatcgaggtggtcggcggcgccggcgacccgttcgag
gcgcggggcatgatcaaggccctgaaccccgacgtcgtgaccctcgacatcgagatgccg
aacatgaacggcatcgacttccttgagaagatcatgcgcctgcggccgatgccggtggtg
atggtctcgaccctgacccaggcgggcgcggaaatgacgctgcgggccctggagctgggc
gcggtggactgcgtcggcaagcccgccgacgccaccggcacccaggaagccctggccgag
atcgtcgcgaaggtgaagatcgccgcccgcgcctcggttcgcacgaacgccggcgcggcg
ccgaccagcgcgcccacgcgccgcaaggacttcatgccctcgggcgacatcgtggcgatc
gggtcgtcgaccggcggggtggaagccctgctgtcgatcctgcaactgttccccgagacc
tgtccgccgaccgtcatcacccagcacatgccggccaccttcacggccagcttcgccgcc
cgcctcgatcgttcgagcggcgcgaaggtgcaggaggcttccgacggcgctttgctggag
cccggcaaggtgtacgtggcgccgggcggcgcgacgcacctcgaagtcgttcgctcggcg
ggcctgcgttgccgtctggtcgcgggcgaccccgtgagcgggcaccgcccctcggtggac
gtgctgttcaactcggtggcgcacgccgtcggcgacaaggcggtgggggtgatcctgacc
ggcatgggccgcgacggcgcccagggcctgctgacgatgcgcaaggccggcgccaagacg
ctgggccaggacgaagcaagctgcgtcgtctacggcatgccccgatccgctttcgaaatc
ggcgccgtggagcgacaggtcagcctgtcctcgatgggccagtccatcctcgatttggcc
tccgcgaggcgatag

DBGET integrated database retrieval system