KEGG   Caulobacter crescentus CB15: CC_0710Help
Entry
CC_0710           CDS       T00049                                 

Definition
hypothetical protein
Orthology
K13593  
cyclic-di-GMP phosphodiesterase, flagellum assembly factor TipF
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(777565..778923)
Genome map
AA seq 452 aa AA seqDB search
MGRNGAGTLIYSTLQAGTGLIACNDSCGRFMRRLMLALLTGAYLCLALLVSLFLLRTGAT
PSVGVSAFIGTLGLCFAFHGLIAQALMGAALRVDIDTIREAHAILLDQIEKVDARVTDLV
DTVAADAQRRSEELSSEVHQLEDLIQQMNDRLEHQLTHQVAAASARTGARDRAPQASHML
QVVQDALAENRVDLYLQPIVSLPQRRTVFYESFSRLRDETGRVMMPAEYLAVAEPEGLMT
AIDNLLLFRCVQIVRRLAKQDRKVGIFCNISLASLGDESFFPQFLEFMQGNKDLAGAVFF
ELGQAAFERRGPVEARHMARLASLGFSFSLDKVNDLDVDFQDLARADVKFLKVGAQMMLD
QLEEQDGKLVITSLPDLNASDFAALTRRYGIEVIVEKVEAEKQVAEVLDLDIGYGQGHLF
GEPRAIRDAVLAEADPPADFIRAPMRRRAVGW
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
ttgggacggaatggcgcagggacgttaatctattcgactcttcaggccgggaccggtctg
attgcgtgtaacgattcgtgtggacggtttatgcgtaggctgatgctggcgctcctgacg
ggcgcttatctctgtctggctttgcttgtctccctgttcctcttgagaacgggagcgact
ccgtccgtgggcgtctcggcgttcatcggcacgttgggcctgtgctttgcgttccacggc
ctgatcgcccaagcgctgatgggcgcggccctgcgcgtcgacatcgacaccatccgcgaa
gcccacgccatcctgctggaccagatcgagaaggtcgacgcccgcgtcaccgacctcgtc
gacaccgtcgccgccgacgcccagcgccgctccgaggagctgtccagcgaagtccaccag
ctggaagacctgatccagcagatgaacgaccgcctggagcaccagcttacccaccaggtc
gccgccgcctcggcccgcaccggcgcccgcgaccgcgccccgcaggccagccacatgctg
caggtggtgcaggacgccctggccgagaaccgggtcgacctctacctgcagccgatcgtc
agcctgccccagcgccgcacggtgttctacgagagcttctcgcgcctgcgcgatgagacc
ggccgtgtgatgatgccggccgagtatctggcggtggccgagcccgagggcctgatgacg
gccatcgacaacctcttgctgttccgctgcgtgcagatcgtgcgccgcctggccaagcag
gaccgcaaggtcgggatcttctgcaacatctcgctggccagcctgggcgacgagagcttc
ttcccgcagttcctggagttcatgcagggcaacaaggacctggccggggcggtgttcttc
gagctgggccaggcggcgttcgagcgtcgcggtccggtcgaggcccgccacatggcccgt
ctggccagcctcggcttcagcttcagcctcgacaaggtcaatgacctggacgtcgacttc
caggacctggctcgcgccgacgtgaagttcctgaaagtcggcgcccagatgatgctggac
cagctggaagagcaggacggcaagctggtcatcacctcgctgcccgacctgaacgccagc
gacttcgccgccctcacccgccgctacggcatcgaggtgatcgtcgagaaggtcgaggcc
gagaagcaggtcgccgaggtgctggatctcgacatcggctatggccagggccacctgttc
ggcgagccgcgcgccatccgcgacgcggtgctggccgaagccgatccgcccgccgacttc
atccgcgccccgatgcgtcgccgcgccgtgggctggtag

DBGET integrated database retrieval system