KEGG   Caulobacter crescentus CB15: CC_0894Help
Entry
CC_0894           CDS       T00049                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00071  Fatty acid degradation
ccr00072  Synthesis and degradation of ketone bodies
ccr00280  Valine, leucine and isoleucine degradation
ccr00310  Lysine degradation
ccr00362  Benzoate degradation
ccr00380  Tryptophan metabolism
ccr00620  Pyruvate metabolism
ccr00630  Glyoxylate and dicarboxylate metabolism
ccr00640  Propanoate metabolism
ccr00650  Butanoate metabolism
ccr00900  Terpenoid backbone biosynthesis
ccr01100  Metabolic pathways
ccr01110  Biosynthesis of secondary metabolites
ccr01120  Microbial metabolism in diverse environments
ccr01130  Biosynthesis of antibiotics
ccr01200  Carbon metabolism
ccr01212  Fatty acid metabolism
ccr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CC_0894
   00630 Glyoxylate and dicarboxylate metabolism
    CC_0894
   00640 Propanoate metabolism
    CC_0894
   00650 Butanoate metabolism
    CC_0894
  Lipid metabolism
   00071 Fatty acid degradation
    CC_0894
   00072 Synthesis and degradation of ketone bodies
    CC_0894
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CC_0894
   00310 Lysine degradation
    CC_0894
   00380 Tryptophan metabolism
    CC_0894
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CC_0894
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CC_0894
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_0894
Enzymes [BR:ccr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CC_0894
Exosome [BR:ccr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Ornatin
Motif
Other DBs
NCBI-GeneID: 941113
NCBI-ProteinID: NP_419711
UniProt: Q9A9R8
Position
complement(987055..988242)
Genome map
AA seq 395 aa AA seqDB search
MSAADPVVIVAYARTPMGGFQGALGGVKATDLGATAVKAAIERAGVAGDKVEQIIMGCVL
PAGLGQAPARQAALGAGLPLSVEATTVNKMCGSGMQAAIMAHDALAAGSVDVVVAGGMES
MTGAPYLMSKHRAGARIGHDQMWDSMYLDGLEDAYTPGKLMGAFAEDSAQTYQFTREAMD
DYATRGLMKAKAAVESGAFKAEITPVSVVTRKGTEVVDTDEQPGKADPAKIPTLRPAFSR
DGGVTAANSSSISDGAAALVMTRESVAKALGLPILAKVVSHAAHAHEPGLFTTAPVPAMQ
KALKKAGWSVADVDLFEVNEAFAVVAMIAQKELGIPDDKLNVNGGACALGHPIGASGARI
LCTLINALQSRGGKKGLASLCIGGGEATAMAIELV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgctgatcccgtcgtcatcgtcgcctacgcccgcacgccgatgggcggcttc
cagggggcgctgggcggggtgaaggccaccgacctgggcgcgacggcggtcaaggccgcg
atcgaacgcgccggcgtggcgggcgacaaggtcgagcagatcatcatgggctgcgtgctg
ccggcgggccttggccaggcgccggcgcgtcaggcggcgctgggcgcgggcctgcccctc
tcggtcgaggccaccaccgtcaacaagatgtgcggcagcggcatgcaggctgcgatcatg
gcccacgacgccctggccgccggcagcgtcgacgtcgtcgtggccggcggcatggagagc
atgacgggcgccccctatctgatgtccaagcaccgggcgggcgcccgcatcggtcacgac
cagatgtgggactccatgtacctggacggcctggaggacgcctacacccccggcaagctg
atgggcgccttcgccgaggacagcgcccagacctaccagttcacccgcgaggcgatggac
gactacgccacgcggggcctgatgaaggccaaggccgccgtcgagagcggcgcgttcaag
gccgagatcacgcccgtcagcgtcgtcacccgcaagggcaccgaggtcgtcgacaccgac
gagcagcccggcaaggccgacccggccaagatcccgaccctgcgcccggccttcagccgt
gacggcggcgtcaccgcagccaattccagctcgatcagcgacggcgccgccgccctggtc
atgacccgtgagagcgtcgccaaggcgctgggcctgccgatcctcgccaaggtggtcagc
cacgccgcccacgcccatgagccgggcctcttcaccaccgccccggtgcccgccatgcag
aaggccctcaagaaggccggctggagcgtcgccgacgtcgacctcttcgaggtcaacgag
gccttcgcggtcgtggccatgatcgcccagaaggaactgggcatccccgacgacaagctc
aacgtcaacggcggcgcctgcgcgctgggccacccgatcggcgcctcgggcgcgcgcatc
ctctgcaccctgatcaacgccctgcagtcgcgcggcggcaagaagggcctggccagccta
tgcatcggcggcggcgaagccacggccatggcgatcgagctggtttga

DBGET integrated database retrieval system