KEGG   Caulobacter crescentus CB15: CC_0950Help
Entry
CC_0950           CDS       T00049                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CC_0950
Enzymes [BR:ccr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CC_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1057052..1057963)
Genome map
AA seq 303 aa AA seqDB search
MTVFVLGSINLDAVARVDDLPRPGETVAGLSLELFLGGKGANQAVAAARMGVATRLMGAV
GGDDSGAGLKAKLAGYGVQVGDVVELPGVPTGQAHVWVANSAENMIVVTAGANAMVTPQQ
VAATTIEGQRVLLCQLETPATAIETLFRAGSAKGALRILNAAPALPQGAALFPLTDILIV
NQTELATYAKLDREPVKLEEVSVAARKLMSRPDQTIIVTLGAAGAAVVRRDEAFLVEGKK
VKAVDTVGAGDCFCGALAATLAAGMDLAEAVETANAAAALSVQKAGAAPSMPNRREVEAF
LEG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttttcgttctcggctcgatcaatctggacgccgtggcgcgcgtcgacgatctg
ccccgccccggggaaaccgtcgcgggcctgtcgctggagctgtttctgggcggcaagggc
gccaaccaggccgtcgccgccgcccgcatgggcgtggccacccgcctgatgggggcggtc
ggcggcgacgacagcggcgccggcctgaaagccaagctggccggctatggcgtgcaggtc
ggcgacgtggtcgaactgccgggcgtgcccacaggccaggcccatgtctgggtcgccaac
agcgccgagaacatgatcgtggtgaccgccggcgccaacgccatggtcacgccccagcag
gtggccgccacgacgatcgagggccagcgggtgctgctctgccagctcgagacgccggcc
acggcgatcgagaccctgttccgcgccggctcggccaagggcgccctgcggatcctgaac
gccgccccggccctgcctcagggcgcggcgctgttcccgctgaccgacatcctgatcgtc
aaccagaccgaactggccacctacgccaagctcgaccgcgagccggtcaagctggaagag
gtctcggtcgccgcccgcaagctgatgagccgccccgaccagaccatcatcgtcacgctc
ggcgcggccggcgcggccgtggtgcggcgcgacgaggccttcctggtcgagggcaagaag
gtcaaggcggtcgacaccgtcggggccggcgactgcttctgcggcgccctggccgccacc
ctggccgccggcatggacctggccgaggccgtcgagacggccaacgccgccgccgccctt
tccgtccagaaagccggcgccgcgccgtcgatgccgaaccgccgcgaggtcgaggcgttt
ctggaggggtga

DBGET integrated database retrieval system