KEGG   Caulobacter crescentus CB15: CC_1063Help
Entry
CC_1063           CDS       T00049                                 

Definition
sensor histidine kinase DivJ
Orthology
K11357  
two-component system, cell cycle sensor histidine kinase DivJ [EC:2.7.13.3]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Two-component system
Cell cycle - Caulobacter
Module
PleC-PleD (cell fate control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_1063
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_1063
Enzymes [BR:ccr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CC_1063
Protein kinases [BR:ccr01001]
 Histidine protein kinases
  Cell cycle family [OT]
   CC_1063
Two-component system [BR:ccr02022]
 Cell cycle family
  PleC-PleD [MD:M00511]
   CC_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1194522..1196315
Genome map
AA seq 597 aa AA seqDB search
MILPTALKSRLALEFETLPDPFRRPAARAAGLDPAHAWRLGWLAAVCLAAAAALFTADSG
GWPVWAALGAGALPALVSLIFTREDERTQSWLLVLWAVGGSLAAVLTGGVGGAMAAWCLA
PVAAASTQDQPKRLAEGAALALIGACVAALTQLSGLAPAAPTGPLAFVLGFLALVTTGLG
LAAGLLIGRRRQGARDDRYASEIIGLETLLDGLPHLAIAVRGQGQVTAVRGAAPPGVTRA
DLVNRGLTGAAAPGDRQRLTAAIAQAHREGSASLTFNPALGVERVVALDMHRVAPNQLVG
VLRDITVERHREHALDQARIDAEALAAGRARFLANMSHELRTPLNAIMGFSDIMRARMFG
PLSDRYAEYAELIHESGGHLLDLINDVLDMSKIEAERFELQRGVFDAREAVQAAMRLLRV
QSDTAGVQLRGVLPPGELEVDADRRALKQIVLNLVSNALKFTPRGGQVTVTAHGYDGVLE
IVVADTGVGISPEDLERLGRPYEQAGGAEQRARGTGLGLSLVRAFAQLHGGEMVIESRLG
AGTTVSVRLPVLLAPMVAATPTPPAAPEAPSAPEPAPTVEEPPPASLGDNVIAFAPR
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctccccaccgcgctaaaaagtcgactggccttggaattcgaaacgcttccagac
ccgttcagacgtccggccgcacgcgccgccgggctcgatcccgcgcacgcctggcggctc
gggtggctggcggctgtctgtctggcggcggcggcggccctgttcaccgccgactccggc
ggttggcctgtgtgggcggcgctcggcgccggcgccctgcccgccttggtctcgctgatc
ttcacgcgggaggacgaacgcacccagtcctggcttttggtgctgtgggccgtgggcggc
tcgctggcggcggtgctgaccggcggcgtgggcggggccatggccgcctggtgtctcgcg
cccgtggcggccgcctccactcaggatcagcccaagcgtctggctgagggcgcggccctg
gccctgatcggcgcctgtgtcgcggcgctgacccagctttccggcctggcgcccgcggcg
ccgacgggaccgctggccttcgttctgggctttctggcgctggtgacgaccggtcttggt
ctcgccgccggcctcctgatcggccggcgtcgccagggcgcgcgcgacgatcgctacgcc
agcgagatcatcggtctggagaccttgctcgacggcctgccgcacctggcgatcgccgtc
cgggggcagggacaggtgaccgccgtgcgcggcgcggcgccgcccggcgtcacccgcgct
gatctcgtcaatcgcggtctgaccggcgcggctgcgcccggcgaccgtcagcgcctgacc
gccgctatcgcccaagctcatcgtgagggctcggccagcctgaccttcaaccccgcgctg
ggcgtcgagcgcgtggtggccctggacatgcaccgcgttgcgccgaaccagctggtcggc
gtgctgcgcgacatcacggtggagcggcatcgcgagcatgcgctcgaccaggcgcgcatc
gacgccgaggccttggccgccggccgcgcgcggttcctagccaatatgagccatgagctt
cgcacgcccctgaacgccatcatgggcttctccgacatcatgcgggcgcggatgtttggt
ccgctgagcgaccgctacgccgagtacgctgagctgatccacgagagcggcggccatctg
ctggacctgatcaacgacgtgctggacatgtccaagatcgaggccgagcggttcgagctg
cagcgcggcgtgttcgacgcgcgcgaggcggttcaggcggcgatgcggctgctgcgcgtt
cagtctgacaccgccggagttcagctgcgcggcgtcctgccgcccggcgagctggaggtc
gacgccgatcgccgcgcgctgaagcagatcgtcctgaacctcgtctcgaacgccctgaag
ttcaccccgcgcggcgggcaggtgaccgtcacggcgcacggctatgacggcgtgctcgag
atcgtggtcgccgatacgggcgtcgggatcagtcctgaggacctggaacgcctggggcgt
ccctacgagcaggccggcggggccgaacagcgcgcgcggggcacgggccttggcctgtcg
ctggtgcgggctttcgcccagctgcatggcggcgagatggtgatcgagagccgcctgggc
gcaggcacgaccgtgtcggtgcgcctgcctgtgctgctggcgccgatggtcgctgccacg
ccgacgccgccagccgcgccagaagcgccgtcggcgccggaacccgctcccacggttgag
gaaccgccgccggccagcctgggcgacaacgtcatcgcctttgcgccgcgctga

DBGET integrated database retrieval system