KEGG   Caulobacter crescentus CB15: CC_1210Help
Entry
CC_1210           CDS       T00049                                 

Definition
(RefSeq) cytochrome C family protein
  KO
K08738  cytochrome c
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr01100  Metabolic pathways
ccr01120  Microbial metabolism in diverse environments
ccr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CC_1210
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Carboxyl_trans
Motif
Other DBs
NCBI-GeneID: 941628
NCBI-ProteinID: NP_420024
UniProt: Q9A8Y7
Position
complement(1370789..1371256)
Genome map
AA seq 155 aa AA seqDB search
MIVSACSKDGGSSSQAPADAPTPAAAPAPTDAEKAAALAALPAPYNTGDLSNGQSKFALC
RSCHTITEGGPDLTGPNLYGVFGRKAGVKEGYSFSDAVKAAGFIWDAQQLDKWLADPRGF
MPGTKMTFAGIKNEKDRIDLIAYLKVETGYQTPAK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtttcggcctgctcgaaggatggcggcagctccagccaggcccccgccgacgca
ccgacgccggctgcagcgcccgcgcccaccgacgccgagaaggccgccgccctcgccgcc
ctgcccgcgccctacaacaccggcgacctgtccaacggccagagcaagttcgcgctctgc
cgctcgtgccacaccatcaccgaaggcggaccggacctgacgggtccgaacctgtacggc
gtcttcggtcgcaaggccggcgtcaaggaaggctacagcttctccgacgctgtgaaggcg
gccggcttcatctgggacgcccagcaactcgacaagtggctggccgatccgcgcgggttc
atgcccggcaccaagatgaccttcgccggtatcaagaacgagaaggatcgcatcgacctg
atcgcctatctgaaggtcgagacgggctaccaaacgccggcgaaatag

DBGET integrated database retrieval system