KEGG   Caulobacter crescentus CB15: CC_1223Help
Entry
CC_1223           CDS       T00049                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ccr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1381088..1382578
Genome map
AA seq 496 aa AA seqDB search
MAQDLILALDQGTTSTRAILFDRAGTALGDASRPLRQSYPADGWVEHDAEEIYAAAVAVL
REVTEASGRMADIAAIGVTNQRETVVVWDRATGRPIHPAIVWQDRRTADVCARLKAEGHE
PRVTEVTGLLLDPYFSATKIAWILDKTPGARARAEAGELLCGTMDCWVIWRLTGGAVHAT
DATNASRTLLFDIGAQAWSSEMLALFNVPSTILPKVLDCVDDYGATQADILGREVPIRGV
AGDQQAALMGQGCVAPGQMKATYGTGCFMLINTGTDRAVSRARLLTTVAARVGGKTTYAL
EGSIFVAGAAIQWLGEGLGITGGPRAAEALARAAKPDHAVVVVPAFTGLGAPWWDAEARG
GIFGLTRDAGLPEIAAATFDACALQSRDLIEAMRADAPTAFGEAAQLRIDGGMAKSAWFS
QRLADLTGLSVRRASYQETTALGAALFAAVGAGLYGSIEEAAEASPAAETLAPAMDDHVR
EAAYARWLDAVPRVRL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagacctgatcctggccctggaccagggcaccaccagcacgcgcgccatcctg
ttcgatcgggcggggacggccctgggcgacgcctcgcgtcctctgcgtcaaagctatccg
gccgacggctgggtcgagcatgacgccgaggagatctacgccgccgccgtcgctgtgctg
cgcgaggtcaccgaggcctccgggcggatggcggacatcgctgcgatcggcgtcaccaac
cagcgcgagaccgtggtcgtctgggatcgggctacgggccgtccgatccatccagccatc
gtctggcaggatcgccgcaccgctgacgtctgcgcgcgcctcaaggccgaggggcatgag
ccgagggtgaccgaggttacgggcctgctgctcgacccctatttctcggcgaccaagatc
gcctggatcctcgacaagacacccggcgccagggcccgggcggaggccggcgagcttttg
tgcggcaccatggactgctgggtgatctggcgactgacgggtggcgccgtgcacgcgacc
gacgccaccaacgcttctcgaaccttgctgttcgatatcggcgctcaggcctggtcgagc
gagatgctggcgttgttcaatgtgccctcgacgatcctgcccaaggtgctggactgcgtc
gacgactatggcgcgacgcaggccgacatcctgggccgcgaggtccccattcggggcgtg
gcgggcgatcagcaggcggcgctgatggggcagggctgtgtcgctccgggccagatgaag
gccacctacggcaccggctgcttcatgctgatcaatacggggactgaccgcgccgtctcg
cgggcgcgcctgttgaccaccgtcgcggcgcgggtcggcggcaagacgacctacgcgctg
gaagggtcgatcttcgttgcaggcgcggcgatccagtggctgggcgaggggctcggaatc
acgggcggtccccgcgccgctgaggcgctggcccgggcggccaagccggatcacgcggtg
gtggtggttcccgcgttcacgggtcttggcgccccctggtgggacgccgaggcgcggggt
gggatcttcggtctgacgcgcgatgcaggactacccgagatcgccgccgccaccttcgac
gcctgtgcgctgcagagccgcgacctgatcgaggcgatgcgcgccgatgcgcccacggcc
tttggcgaagcggcgcaactgcggatcgacggcggtatggccaagagcgcctggttctcg
cagcggctggccgatctcacggggctctcggtgcgccgcgccagctatcaggagaccacg
gccctgggggcggcgttgttcgccgccgtcggcgcgggtctctacgggtcgatcgaagag
gccgccgaagccagtccagccgccgagaccttagcgccggccatggacgaccatgtgcgg
gaagccgcctacgcccgttggctcgacgcggtgccgcgcgttcgactttag

DBGET integrated database retrieval system