KEGG   Caulobacter crescentus CB15: CC_1223Help
Entry
CC_1223           CDS       T00049                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CC_1223
Enzymes [BR:ccr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CC_1223
Exosome [BR:ccr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1381088..1382578
Genome map
AA seq 496 aa AA seqDB search
MAQDLILALDQGTTSTRAILFDRAGTALGDASRPLRQSYPADGWVEHDAEEIYAAAVAVL
REVTEASGRMADIAAIGVTNQRETVVVWDRATGRPIHPAIVWQDRRTADVCARLKAEGHE
PRVTEVTGLLLDPYFSATKIAWILDKTPGARARAEAGELLCGTMDCWVIWRLTGGAVHAT
DATNASRTLLFDIGAQAWSSEMLALFNVPSTILPKVLDCVDDYGATQADILGREVPIRGV
AGDQQAALMGQGCVAPGQMKATYGTGCFMLINTGTDRAVSRARLLTTVAARVGGKTTYAL
EGSIFVAGAAIQWLGEGLGITGGPRAAEALARAAKPDHAVVVVPAFTGLGAPWWDAEARG
GIFGLTRDAGLPEIAAATFDACALQSRDLIEAMRADAPTAFGEAAQLRIDGGMAKSAWFS
QRLADLTGLSVRRASYQETTALGAALFAAVGAGLYGSIEEAAEASPAAETLAPAMDDHVR
EAAYARWLDAVPRVRL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagacctgatcctggccctggaccagggcaccaccagcacgcgcgccatcctg
ttcgatcgggcggggacggccctgggcgacgcctcgcgtcctctgcgtcaaagctatccg
gccgacggctgggtcgagcatgacgccgaggagatctacgccgccgccgtcgctgtgctg
cgcgaggtcaccgaggcctccgggcggatggcggacatcgctgcgatcggcgtcaccaac
cagcgcgagaccgtggtcgtctgggatcgggctacgggccgtccgatccatccagccatc
gtctggcaggatcgccgcaccgctgacgtctgcgcgcgcctcaaggccgaggggcatgag
ccgagggtgaccgaggttacgggcctgctgctcgacccctatttctcggcgaccaagatc
gcctggatcctcgacaagacacccggcgccagggcccgggcggaggccggcgagcttttg
tgcggcaccatggactgctgggtgatctggcgactgacgggtggcgccgtgcacgcgacc
gacgccaccaacgcttctcgaaccttgctgttcgatatcggcgctcaggcctggtcgagc
gagatgctggcgttgttcaatgtgccctcgacgatcctgcccaaggtgctggactgcgtc
gacgactatggcgcgacgcaggccgacatcctgggccgcgaggtccccattcggggcgtg
gcgggcgatcagcaggcggcgctgatggggcagggctgtgtcgctccgggccagatgaag
gccacctacggcaccggctgcttcatgctgatcaatacggggactgaccgcgccgtctcg
cgggcgcgcctgttgaccaccgtcgcggcgcgggtcggcggcaagacgacctacgcgctg
gaagggtcgatcttcgttgcaggcgcggcgatccagtggctgggcgaggggctcggaatc
acgggcggtccccgcgccgctgaggcgctggcccgggcggccaagccggatcacgcggtg
gtggtggttcccgcgttcacgggtcttggcgccccctggtgggacgccgaggcgcggggt
gggatcttcggtctgacgcgcgatgcaggactacccgagatcgccgccgccaccttcgac
gcctgtgcgctgcagagccgcgacctgatcgaggcgatgcgcgccgatgcgcccacggcc
tttggcgaagcggcgcaactgcggatcgacggcggtatggccaagagcgcctggttctcg
cagcggctggccgatctcacggggctctcggtgcgccgcgccagctatcaggagaccacg
gccctgggggcggcgttgttcgccgccgtcggcgcgggtctctacgggtcgatcgaagag
gccgccgaagccagtccagccgccgagaccttagcgccggccatggacgaccatgtgcgg
gaagccgcctacgcccgttggctcgacgcggtgccgcgcgttcgactttag

DBGET integrated database retrieval system