KEGG   Caulobacter crescentus CB15: CC_1336Help
Entry
CC_1336           CDS       T00049                                 

Definition
GHMP family kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CC_1336
Enzymes [BR:ccr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CC_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1490969..1491856
Genome map
AA seq 295 aa AA seqDB search
MSHEIMRLSAFAPAKVNLFLHVGGPDGEGYHPISSLMVFADVGDRVNLQPADAPAFETSG
PFGDQIPAGGDNLVVRAGQAFHRRLGGPVPPYRLILEKHLPIAAGLGGGSSDAGAALKLL
RDALAPALSDDDLEALAASLGADGAACLRARALIAEGRGERLSPAPRLPELNAVLVNPGA
PSPTGAVYRAYDAGVHPDGAAMPPMPDHLESAEEAAAWLAFATRNDLEAPAVRLEPHIGE
VLDVLRGEPESLLVRMSGSGATCFALCASDIEAEGLAERLETMRPDWWVRRCRLS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcacgagatcatgcggctgtcagcgttcgccccggccaaggtcaatctgttcctg
catgtcggcgggccggacggggagggctatcatccgatctccagcctgatggtgttcgcc
gatgtcggcgaccgggtgaacctccagcccgccgacgcgccggcgttcgagacgtccggg
ccgttcggggatcagattcccgccggcggcgacaatctggtggtccgcgcaggccaggct
ttccacaggcggctcggcggtccggttccgccttatcggctgatcctggagaagcacttg
ccgatcgctgcgggcctgggcgggggctccagcgacgcgggtgcggcgctcaagctgttg
cgtgacgccctggccccggcgctttccgatgacgatctggaggcgctggctgcgagcctt
ggcgcggacggcgcggcctgtctgcgcgcgcgcgcccttatcgcagaagggcgaggcgag
cggctgtcgccggcgccgcggttgcccgagttgaacgcagtgctggtcaatcccggcgcg
ccgtcgccgaccggcgcggtctatcgcgcctatgacgcgggcgtgcacccagacggcgcc
gccatgccccccatgcccgaccatctggagagcgctgaggaggccgccgcctggttggcc
tttgcgacacgcaacgacctggaggcgccggccgtgaggcttgagccgcacatcggcgag
gtgctggacgtgctgcggggcgagccggaaagtctgctggtccgcatgtcgggttcgggt
gcgacctgtttcgcgctctgcgccagcgatatcgaggccgaaggtctggccgagcgcctg
gagacgatgcgtccggactggtgggtgcggcgctgccgcctgagctga

DBGET integrated database retrieval system