KEGG   Caulobacter crescentus CB15: CC_1347Help
Entry
CC_1347           CDS       T00049                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CC_1347
Enzymes [BR:ccr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CC_1347
Exosome [BR:ccr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1500580..1501584)
Genome map
AA seq 334 aa AA seqDB search
MTTPPLAPYPHTRLRRVRQSDWVRRLVRETEVRPSDLIWSMVVHEGEGTIPVASMPGVER
LSVKEAAKAAVRARDLGIPAIAIFPHIDGSRKDAAGSIAADPDGVIPRAVKAMKDAAPEV
GIMCDVALDPFTDHGHDGVVEGGKILNDATIERLIEQGLMQADAGADILAPSDMMDGRIG
KLRAALEGANYQDVMIMSYAAKYASAFYGPYRDAIGSAKLSAGQGDKKTYQMDPANTEEA
IREVALDIAEGADMVMVKPGMPYLDILRRLVEEFRMPTYAFQVSGEYAMIMAAAQNGWID
KDRAILESLTAFKRAGAAGIITYFAPWAAEKLGA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgccgcccctcgccccctatccgcacacccgcctgcgccgcgtgcgccagagc
gactgggtccgtcgcctggtccgcgagaccgaggttcgcccgtccgacctgatctggtcg
atggtggtgcacgagggcgaaggaaccatcccggtggcctccatgcccggcgtcgaacgc
ctgtcggtgaaggaagccgccaaggccgccgtccgcgcccgagatctgggcatcccggcc
atcgccatcttcccgcatatcgacgggtcgcggaaagacgcggccggctcgatcgccgcc
gatccggacggggtgatcccccgcgcggtcaaggccatgaaggacgccgcccccgaggtc
gggatcatgtgcgacgtggcgctggaccccttcacggaccacggccacgacggcgtggtc
gagggcggcaagatcctcaacgacgccacgatcgagcgcctgatcgaacagggcctgatg
caggccgatgccggcgccgacattctggcgccgtccgacatgatggacggccgcatcggc
aagctgcgcgccgcgctggaaggcgcgaactatcaggacgtgatgatcatgtcctacgcg
gccaaatacgcctcggccttctatggcccgtaccgcgacgccatcggctcggccaagctg
tcggccggccagggcgacaagaagacctaccagatggacccggccaataccgaggaagcc
atccgcgaagtcgccctcgacatcgccgagggcgccgacatggtcatggtcaagccgggc
atgccttatctggacatcctgcgccgcctggtcgaggagttccgcatgcccacctacgcc
ttccaggtgtcaggcgagtacgcgatgatcatggccgccgctcagaacggctggatcgac
aaggaccgcgccatcctggaaagcctgaccgccttcaagcgcgccggcgcggccgggatc
atcacctatttcgcaccctgggcggcggagaagctgggggcttga

DBGET integrated database retrieval system