KEGG   Caulobacter crescentus CB15: CC_1418Help
Entry
CC_1418           CDS       T00049                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ccr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ccr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1565560..1566696)
Genome map
AA seq 378 aa AA seqDB search
MTLKTIALCGATLMLAGGVQAAELSRKPFGKLPSGEAVEALTLTNGAGVSATVITYGATL
QSLIAPGRDGEKADIALGFADAAGYASNNSYFGASVGRFANRIGKGRFSLDGKTYQLALN
NDGVAALHGGVKGFDKVVWKVLETKAGPVASVTFGYVSPDGEEGYPGTLTVTATYALDEQ
NQLTITYGATTDKPTIVNLTNHALFNMAGEGAPEGAMGNVLTIPADGYTPVDSELIPTGA
VSPVAGTAFDFRKPTVVGDRIRDARDPQLVIGRGYDHNYVLNGPSGGAPRLAARLSDPKS
GRTLEILSTEPGLQFYAGNFMNGLMVGKSGKMYRQGDGIALEPQHFPDAPNKPQFASTRL
DPGQTYRNTMVFRLSVDR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcaagaccatcgccctgtgcggcgcgaccttgatgctcgccggcggggtccag
gcggccgagctctcgcggaagcccttcggcaagctcccatcgggcgaggcggtcgaggcc
ctcaccctgaccaacggcgccggcgtcagcgcgacggtgatcacctatggcgcgaccttg
cagtcactgatcgcgccggggcgcgatggcgagaaggcggacatcgcgctgggcttcgcc
gacgccgctggctacgccagcaacaacagctacttcggggccagcgtcgggcggttcgcc
aatcggatcggcaagggtcgcttcagcctcgacggcaagacctaccaactggccctgaac
aacgacggcgtcgcggcgctgcacggcggcgtcaagggcttcgacaaggtggtctggaag
gtgctggagaccaaggcaggtccggtcgcatccgtaacgttcggctatgtgagtcccgac
ggcgaagagggttatccgggcacgctgacggtcacggcgacctatgcactcgacgaacag
aaccagctgacgatcacctacggcgcgacgaccgataagccgaccatcgtcaacctgacc
aaccacgcgctcttcaacatggccggcgaaggcgctcccgaaggcgcgatgggcaatgtg
ctgaccattcctgcggatggctacacgccggtcgattctgaactgatcccgaccggcgcg
gtcagccctgtggccgggaccgcctttgatttccgcaaaccgactgtggtcggggaccgc
atccgcgatgcgcgcgatccccagttggtcatcgggcgcggctacgatcacaactacgtc
ttgaacggaccgtcgggtggcgctccgcgactggcggctcgcctgtcagatcccaagagc
ggcaggaccctggaaatcctgtccaccgagcccggcctgcagttctacgccggcaacttc
atgaacggcttgatggtgggcaagagcggtaagatgtaccgccagggcgacggcatcgca
ctggagccgcagcattttccggatgcgcccaacaagccgcaattcgcatcgacgcggcta
gatcctggccagacctaccgtaacacgatggtgttccggctgagcgtcgaccgctag

DBGET integrated database retrieval system