KEGG   Caulobacter crescentus CB15: CC_1551Help
Entry
CC_1551           CDS       T00049                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ccr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1715049..1715582
Genome map
AA seq 177 aa AA seqDB search
MKNQVARNDLDEAVIVALGCNLPGAYTSREALLEAAVAALPQVGLEVVTRSGWWTSAAWP
DPAGPAYLNGVAVVRTTLSPRQVLDALHSLEARFGRARGEANAPRTLDLDLIAHGRTVLD
DGLVVPHPRAHQRLFVMGPLSELYSGWIHPVTGEPAFRLAATATVGRDARPMAAPTA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatcaggtcgctcgaaatgacttggacgaggccgtgatcgtggcgctcggctgc
aatctgcccggagcctatacgagtcgcgaggccttgttggaagccgccgtggcggcgctg
ccgcaggtcgggctggaggtggtgacgcggtcgggctggtggacctccgccgcttggcct
gacccggcggggcccgcgtatctgaacggcgtggcggtcgtgcggacgacgctctcgccg
cgtcaggtcctggacgcgctgcattcactggaggcgcggttcgggcgggcgaggggagag
gccaatgcgccgcgcactctggacctggatctcatcgcccatggccgcacggtgttggac
gatggcctggtggtgccgcatccgcgcgcccaccagcggctgtttgtgatggggccgctt
tcggagctgtattctggctggattcaccctgtcaccggcgagccggcctttcgcctggcg
gcgaccgcgacggtcggccgcgatgcgcgaccaatggcggcgccgacggcctag

DBGET integrated database retrieval system