KEGG   Caulobacter crescentus CB15: CC_1632Help
Entry
CC_1632           CDS       T00049                                 

Definition
cytochrome C family protein
Orthology
K08738  
cytochrome c
Organism
ccr  Caulobacter crescentus CB15
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CC_1632
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_1632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1810193..1810525
Genome map
AA seq 110 aa AA seqDB search
MFAALASGAVAAPSGQQLFEQRCGMCHSLQQAPGKMGPPLAGVVGRKAASFPGYTYSAAL
KGSGITWTADKLDAYSKAPTKVVPGTKMLLGAPNDAERAAVIAYLASVKK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgcagccctggcgtctggcgcggtcgccgcgccgtctggacagcagctgttcgag
cagcggtgcggcatgtgccattcgctgcagcaggctcccggcaagatggggccgcccttg
gcgggtgtggtcggtcgcaaggcggcgagctttccgggctacacctacagcgcggcgctg
aagggctcgggaatcacctggaccgccgacaagctcgacgcctattcgaaggccccgacc
aaggtcgtgccgggcaccaagatgctgttgggagcgcccaacgacgccgagcgcgcggcg
gtgatcgcctatctggccagcgtcaagaaatag

DBGET integrated database retrieval system