KEGG   Caulobacter crescentus CB15: CC_1665Help
Entry
CC_1665           CDS       T00049                                 

Definition
replicative DNA helicase
Orthology
K02314  
replicative DNA helicase [EC:3.6.4.12]
Organism
ccr  Caulobacter crescentus CB15
Pathway
DNA replication
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CC_1665
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_1665
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CC_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1838925..1840448)
Genome map
AA seq 507 aa AA seqDB search
MPMSLVPALDLVLPGLPEPTINVAPHNMEAEQALLGVLLYDNAAYERLSDNLQARCFYEP
FHQRLFQAIETHVRKGQLAEPILLADEFKKDPAFEELGGLRYLADLVDRAPPAANVGDYA
RVIFDLSLRRELIRIGGDIATAAQGGNDEKRNARDQIEAAEQSLYSLAESGAASSGFVSF
GDALRGAVEMTAEAYSRDGGMSGVSTDLMDLDQKIGGLHPSDLIILAGRPSMGKTALATN
IAFNIAKKYAYEIQPDGTKKTVQGGVVAFYSLEMSAEQLALRMLADASGVSGDRLRKGEI
DASEFGRVRDAAMELQNAPLYIDATGGISIAKLTARARRLKRQVGLDLIVVDYLQLVTGS
DLGANANRVQEVSQITMGLKALAKELSVPVIALSQLSRQVEQRDDKRPQLSDLRESGSIE
QDADMVWFVYREAYYVGRAEPREGTPEHLTWQEEMDRLQGLAEVIIAKQRHGPIGTVRLS
FNSDTTRFGNLARDHYFAQARNIPSDE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgccgatgtctctcgtccctgcgctcgacctcgttcttcccggtcttcccgagcccacg
atcaacgtggcgccgcacaacatggaagccgaacaagcgctgctgggcgtcctgctgtat
gacaacgccgcctatgagcgcctgagcgacaatctgcaggcccgctgcttctacgagccc
ttccaccagcgtctgttccaggcgatcgagacccacgtccgcaagggccagctggccgag
ccgatcctgctggccgacgagttcaagaaagaccccgccttcgaggagctgggcggtctg
cgctatctggccgacctcgtcgaccgcgcgccgccagcggccaatgtcggcgactacgcc
cgcgtgatcttcgacctgtcgctgcgtcgcgaactgatccgcatcggcggcgacatcgcc
acggcggcgcaaggcggcaacgacgaaaagcgtaacgcccgcgatcagatcgaggcggcg
gaacagagcctctacagcctggccgaaagcggcgcggcctcttcgggcttcgtgtccttc
ggcgacgccctgcgcggcgcggtcgagatgaccgccgaggcctatagccgcgacggcggc
atgtcgggcgtctcgaccgacctgatggacctcgaccagaagatcggcggtctgcacccg
tccgacttgatcatcctggccggacgcccctcgatgggtaagacggccctggcgaccaac
atcgccttcaacatcgccaagaagtacgcctacgagatccagcccgacgggacgaaaaag
accgtccagggcggcgtggtggccttctattcgctggaaatgagcgccgagcagctggcc
ctgcgtatgctggccgacgcctcgggcgtgtcgggcgaccgcctgcgtaagggcgagatc
gacgccagcgagttcggccgcgtgcgcgacgcggccatggagctgcagaacgcgccgctc
tatatcgacgccaccggtggtatctcgatcgccaagctgaccgctcgggcccgccgtctg
aagcgccaggtgggccttgatctcatcgtggtcgactacctacagctggtcaccggctcg
gacctcggcgccaacgctaaccgcgtgcaggaagtctcgcagatcaccatgggcctgaag
gctctggccaaggagctcagcgtcccggtcatcgccctgtcgcagctgtcgcgtcaggtc
gaacagcgtgacgacaagcgcccccaactttcggacctgcgggaatcgggctcgatcgaa
caggacgccgacatggtctggttcgtgtaccgcgaggcctattatgtgggccgcgccgaa
ccgcgcgaaggcacgcccgagcacctgacctggcaggaagagatggaccggctccagggg
ctggccgaagtgatcatcgccaagcaacgccacggccccatcggcaccgtgcgcctgtcg
ttcaacagcgacaccacccgctttggcaacctggcccgcgaccactacttcgcccaggcg
cggaatattccgtcggacgagtag

DBGET integrated database retrieval system