KEGG   Caulobacter crescentus CB15: CC_1726Help
Entry
CC_1726           CDS       T00049                                 

Definition
pyruvate dehydrogenase E1 component subunit alpha
Orthology
K00161  
pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ccr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ccr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ccr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ccr00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1897981..1899012
Genome map
AA seq 343 aa AA seqDB search
MARTRKAEASEGKAPETGVNAFVGKDELLKFYQDMLLIRRFEERAGQLYGMGLIGGFCHL
YIGQEAIAVGMQSISQKGDQIITGYRDHGHMLAAGMDPREVMAELTGRAGGSSKGKGGSM
HMFDIATGFYGGHGIVGAQVALGTGLALANSYRNNGNVSYAYMGDGAANQGQVYESFNMA
QLWKLPVVYVIENNQYAMGTAVERAASETAFHKRGVSFRIPGEEVDGMDVIAVREAGARA
TEHARSGQGPYILEMKTYRYRGHSMSDPAKYRTKEEVDEVKTTRDPIDHIKERLAKAGVT
EDDLKGVDAEVKRIVAEAAEFARTSPEPDPSELYTDVYLEAAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcacgcgcaaggctgaagcctccgaggggaaggcgccggaaaccggtgtcaac
gccttcgtcggcaaggacgaactcctgaaattctatcaggacatgctgctcatccgccgc
ttcgaggagcgggcgggtcagctgtacggcatgggcctgatcggcggcttctgccacctg
tacatcggtcaggaagccatcgcggtcggcatgcagtcgatctcgcagaagggcgaccag
atcatcacgggctatcgtgaccacggccacatgctggcggcgggcatggatccccgcgag
gtgatggctgaactgaccggccgtgccggcggctcgtccaagggcaagggcgggtcgatg
cacatgttcgacatcgccaccggcttctacggcggtcacggcatcgtcggcgcccaggtc
gcgctcggcaccggtctggccttggccaacagctaccgcaacaacggcaacgtctcctac
gcctatatgggcgatggcgcggccaaccagggtcaggtctacgagagcttcaacatggcc
cagctgtggaagctgccggtcgtgtacgtgatcgagaacaaccagtacgccatgggcacc
gccgtcgagcgcgccgcctcggaaaccgcgttccacaagcgcggcgtctcgttccgcatt
ccgggcgaggaagtcgacggcatggacgtcatcgccgtccgcgaagccggcgctcgcgcc
accgaacacgcccgtagcggccaaggtccctacatcctcgagatgaagacctaccgctat
cgcggtcactcgatgtcggatccggccaagtaccgcaccaaggaagaggtcgacgaggtc
aagacgacccgcgatcccatcgatcacatcaaggaacgcctggccaaggccggcgtgacc
gaagacgacctgaagggcgtcgacgccgaagtgaagcgcattgtcgccgaggccgccgaa
ttcgcccgcacgagccccgagcccgatccctcggaactgtataccgacgtctacctggag
gccgccgagtga

DBGET integrated database retrieval system