KEGG   Caulobacter crescentus CB15: CC_1726Help
Entry
CC_1726           CDS       T00049                                 

Definition
pyruvate dehydrogenase E1 component subunit alpha
Orthology
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CC_1726
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC_1726
   00020 Citrate cycle (TCA cycle)
    CC_1726
   00620 Pyruvate metabolism
    CC_1726
Enzymes [BR:ccr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     CC_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1897981..1899012
Genome map
AA seq 343 aa AA seqDB search
MARTRKAEASEGKAPETGVNAFVGKDELLKFYQDMLLIRRFEERAGQLYGMGLIGGFCHL
YIGQEAIAVGMQSISQKGDQIITGYRDHGHMLAAGMDPREVMAELTGRAGGSSKGKGGSM
HMFDIATGFYGGHGIVGAQVALGTGLALANSYRNNGNVSYAYMGDGAANQGQVYESFNMA
QLWKLPVVYVIENNQYAMGTAVERAASETAFHKRGVSFRIPGEEVDGMDVIAVREAGARA
TEHARSGQGPYILEMKTYRYRGHSMSDPAKYRTKEEVDEVKTTRDPIDHIKERLAKAGVT
EDDLKGVDAEVKRIVAEAAEFARTSPEPDPSELYTDVYLEAAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcacgcgcaaggctgaagcctccgaggggaaggcgccggaaaccggtgtcaac
gccttcgtcggcaaggacgaactcctgaaattctatcaggacatgctgctcatccgccgc
ttcgaggagcgggcgggtcagctgtacggcatgggcctgatcggcggcttctgccacctg
tacatcggtcaggaagccatcgcggtcggcatgcagtcgatctcgcagaagggcgaccag
atcatcacgggctatcgtgaccacggccacatgctggcggcgggcatggatccccgcgag
gtgatggctgaactgaccggccgtgccggcggctcgtccaagggcaagggcgggtcgatg
cacatgttcgacatcgccaccggcttctacggcggtcacggcatcgtcggcgcccaggtc
gcgctcggcaccggtctggccttggccaacagctaccgcaacaacggcaacgtctcctac
gcctatatgggcgatggcgcggccaaccagggtcaggtctacgagagcttcaacatggcc
cagctgtggaagctgccggtcgtgtacgtgatcgagaacaaccagtacgccatgggcacc
gccgtcgagcgcgccgcctcggaaaccgcgttccacaagcgcggcgtctcgttccgcatt
ccgggcgaggaagtcgacggcatggacgtcatcgccgtccgcgaagccggcgctcgcgcc
accgaacacgcccgtagcggccaaggtccctacatcctcgagatgaagacctaccgctat
cgcggtcactcgatgtcggatccggccaagtaccgcaccaaggaagaggtcgacgaggtc
aagacgacccgcgatcccatcgatcacatcaaggaacgcctggccaaggccggcgtgacc
gaagacgacctgaagggcgtcgacgccgaagtgaagcgcattgtcgccgaggccgccgaa
ttcgcccgcacgagccccgagcccgatccctcggaactgtataccgacgtctacctggag
gccgccgagtga

DBGET integrated database retrieval system