KEGG   Caulobacter crescentus CB15: CC_1729Help
Entry
CC_1729           CDS       T00049                                 

Definition
(RefSeq) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00010  Glycolysis / Gluconeogenesis
ccr00020  Citrate cycle (TCA cycle)
ccr00620  Pyruvate metabolism
ccr01100  Metabolic pathways
ccr01110  Biosynthesis of secondary metabolites
ccr01120  Microbial metabolism in diverse environments
ccr01130  Biosynthesis of antibiotics
ccr01200  Carbon metabolism
Module
ccr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC_1729
   00020 Citrate cycle (TCA cycle)
    CC_1729
   00620 Pyruvate metabolism
    CC_1729
Enzymes [BR:ccr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CC_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 PYNP_C Peptidase_M23 DUF2118
Motif
Other DBs
NCBI-GeneID: 942077
NCBI-ProteinID: NP_420537
UniProt: Q9A7J4
Position
1900945..1902231
Genome map
AA seq 428 aa AA seqDB search
MSIDILMPALSPTMEEGTLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGVVEAIL
VPAGTENVKVNALIAKLAGEGDSPAPAPKVEAPKAAAAAPVPAAAPAPAVPAPAAPVAAD
GSRVLASPLARRLASAAGLDLKALKGTGPHGRVVKSDVEAAKSGAPAAKAAPASAPAAVA
PTAAAPRQIQSLEQMGIPAGSYDLVPLDGMRKTIARRMTESFRDVPHFPLTIDLEIDALL
AARAKINSLLEKQGVKVSVNDIVIKAAAVALKQVPEANASYTPEGIAMHHHADIAVAVAV
DGGLITPIIRKAETKGLAQISAEMKDLAQRAKDKKLKPEEFQGGTFSISNLGMFGIKSFA
SIINEPQGAIMSVGAGEQRPVVKNGEIKVATVMTVTLTCDHRVVDGSVGAKFLAAFRPLI
EEPLTLIV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgacatcctgatgcccgccctgtcgcccaccatggaggagggaaccctcgcc
aagtggcacgtcaaggtcggcgacaccgtcaaggccggcgacgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggcgtcgtggaagccatcctg
gttccggccgggaccgagaacgtcaaggtcaacgccctgatcgccaagctggcgggcgag
ggcgacagccccgcgccggccccgaaggtcgaagccccgaaagccgccgccgctgcgccg
gttccggccgccgccccggctccggccgtgcccgcgccggccgctccggtcgccgctgac
ggctcgcgcgtcctggcctcgcccctggcccgccgtctggcttcggccgccggtctcgac
ttgaaggccctcaagggcaccggcccgcacggccgcgtcgtgaagtcggacgtcgaagcc
gccaagtcgggcgcgccggccgctaaggctgctccggcctcggcgcccgccgccgtcgct
ccgaccgccgccgcgccgcgtcagattcagtcgctggagcagatgggcattcccgccggc
tcctacgacctcgtcccgctggacggcatgcgcaagacgatcgcccgtcgcatgacggag
agcttccgcgacgtgccgcacttcccgctcacgatcgatctcgagatcgacgccctgctg
gccgcccgcgccaagatcaacagcctgctggaaaagcagggcgtgaaggtctcggtgaac
gacatcgtcatcaaggccgccgccgtggccctgaagcaggtgccggaagccaacgccagc
tacacgccggaaggcatcgccatgcaccaccacgccgacatcgccgtcgccgtggccgtc
gatggcggcctgatcaccccgatcatccgcaaggccgagaccaagggcctggcgcagatc
tccgccgagatgaaggacctggcccagcgcgccaaggacaagaagctgaagcccgaagag
ttccagggcggcaccttctcgatcagcaacctcggcatgttcggcatcaagtcgttcgcc
tcgatcatcaacgagccgcaaggcgcgatcatgagcgtcggcgcgggcgaacagcgtccg
gtcgtcaagaacggcgagatcaaggtcgccacggtcatgaccgtgaccttgacctgcgat
caccgcgtggtcgacggctcggtcggcgccaagttcctggcggccttcaggccgctgatt
gaagagccgctgaccctgatcgtctga

DBGET integrated database retrieval system