KEGG   Caulobacter crescentus CB15: CC_1730Help
Entry
CC_1730           CDS       T00049                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CC_1730
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CC_1730
Enzymes [BR:ccr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CC_1730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1902250..1902732
Genome map
AA seq 160 aa AA seqDB search
MAMSIYDYSAKTLDGQDVSLADYRGQVLLIVNTASKCGFTPQYEGLEALYKAHKDRGFTV
LAFPCNQFGAQEPGNAEEIANFCSLTYDVSFPVMSKIDVNGADAHPLYKFLKKEQKGVLG
TEAIKWNFTKFLIGKDGQVVDRFAPTVKPEDLKVAVEALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtcgatctacgactattccgccaagacgctggacggccaggacgtgagcctg
gccgactatcgcggccaagtgctgctgatcgtgaacaccgccagcaagtgcgggttcacg
ccgcagtacgagggcctggaagcgctctacaaggcgcacaaggaccgtggcttcacggtc
ctggccttcccctgcaatcagttcggcgctcaggagccgggtaacgccgaggaaatcgcg
aacttctgctcgctgacctacgacgtgagcttcccggtcatgagcaagatcgacgtcaac
ggcgccgacgcccacccgctctacaagttcctcaagaaggaacagaagggcgtcttgggc
accgaggcgatcaagtggaacttcaccaagttcctgatcggcaaggacggccaggtcgtc
gatcggttcgcgccgaccgtgaagcccgaagacctgaaggtcgcggtcgaggcgctgctc
tag

DBGET integrated database retrieval system