KEGG   Caulobacter crescentus CB15: CC_1734Help
Entry
CC_1734           CDS       T00049                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CC_1734
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CC_1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1907367..1908443)
Genome map
AA seq 358 aa AA seqDB search
MRRRLLAAVPAIALSLAVSACGDGASRAPFAESRTPPALTARFYPPQGWAWGYIQSGGGP
VQRYGVAAPPVSPRGTILILTGYGETAEKWFETVSDLTRRGFTVWVLERQGQGGSERLTP
WRDLGHIDSFDPDVAVVKALVNTVIRPKGGTRFVVLGHGEGGLVALRAAQTGLPMDALVL
SSPAFGLSALPRPRSDFARFTPALRTLRLGWVRSSDQRGWRRDGPDGKAAGLTHDADRGK
VQAAWMLANPDLRMGGRSLGWFAAFFDASEAAARDIGKATVPVLMLNAGRDRVVTAKPQT
RLCREMKACREIHYAEGAHDLHMESDAVRVPWLTEVAKLAAPDAPPKPSPTKDQGHGL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccgtctcctcgcagccgtcccggctatcgcgctcagcctggccgtctccgct
tgcggcgacggggcctcccgcgcgccgtttgcagagagtcgaacaccacccgccctgacc
gcccgcttctatccgccgcagggatgggcctggggatacatccagtccggcggcggtcca
gtgcagcgctacggcgtcgccgcgccgccggtgtcgccccgaggaacgatcctgatcctc
accggttatggcgaaacagctgaaaagtggttcgaaaccgtgtcggacctcacgcggcgc
ggctttaccgtctgggtcctagaacgtcagggacagggcgggtctgaacgactgacgccg
tggcgtgatcttggccacatcgacagcttcgatcctgacgtggcggtcgtcaaagcgctg
gtcaatactgtgatccgccccaagggcgggacacgcttcgttgtgctgggacatggtgaa
ggcggtttagtcgcgctgcgagcggcgcagacaggtctgccgatggacgcccttgtgctc
tcatccccggcgttcggcctgagcgccctaccccggccccgctccgatttcgccagattt
acgccggcgctgagaaccctccgactgggctgggtccgctcttcggaccagaggggctgg
cgtcgagacggtccagacggcaaggctgctggcctcacccacgacgccgaccgtggcaag
gttcaggccgcctggatgctggccaaccccgatcttcgcatgggcgggcggagcctggga
tggttcgccgcgttcttcgacgcgtcagaggccgccgcgcgcgatattggcaaggcgacc
gtccccgtcctgatgctcaacgccggccgtgaccgcgtcgtcaccgcaaagcctcaaacg
cgcctctgcagagaaatgaaggcctgccgcgagatccactacgccgaaggcgcacacgac
ctgcacatggaatcggacgccgttcgcgtcccttggctcaccgaagttgcgaagctcgca
gcgcccgatgcgccgccaaaacccagtccgacgaaggatcaaggtcacggattgtga

DBGET integrated database retrieval system