KEGG   Caulobacter crescentus CB15: CC_1757Help
Entry
CC_1757           CDS       T00049                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Other glycan degradation
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ccr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1937509..1938918
Genome map
AA seq 469 aa AA seqDB search
MRLRLLSITVAALAATSPVLAAPKLRAWVTTGDKSQLLAAQAPVAASSAEALAGLPVIAV
DAQERHQSIVGFGASITDASAWLIQNKLKPADRDALLRELFGRGAGGLGFSFTRVTIGAS
DFSLDHYSLNDTPDGAPDPELKHFSLARPKQHVFPTVRAALKINPELKVMASPWSAPAWM
KTTGSLLKGQLKAEAYPVYATFFARYVQEAAKVGVPTDYLSVQNEPDFEPENYPGMRWLP
QDRARFFGEHLAPVFKRDKIKTRVLDWDHNWDQPQQPLTVLADPKARAFLTGVAWHCYAG
EVSAQDKVRAAYPDKEVFFTECSGGEWAPKFDDSFAWMVEQLIIGSTRGGARGVLMWNLA
LDEKFGPHAGGCGDCRGVVSIDSQTGALTRTQEYYAFGHASRFVKPDAVRIGSPAKVEGL
RTVAFQNPDGQRVLIVLNVSTAAVDFAIASAGARFKASLPARSAGTFVW
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttcgccttttgtccatcacggtcgcggcgctggccgcgacctcgccggtcctg
gccgcgcccaagctccgcgcctgggtgacgaccggcgacaagagccagctcctggccgcg
caggcgccagtggcggcctcgtccgccgaggcgctggccggactgccggtgatcgcggtc
gacgcccaggagcgtcatcagtcgattgtcggcttcggcgcgtcgatcaccgacgcctcg
gcctggctgatccagaacaagctcaagcccgccgaccgtgacgcgctgctgcgcgaactg
ttcggacgcggggcgggcggtctgggcttcagcttcacccgcgtgaccatcggcgcgtcc
gacttttcgctggaccactacagcctcaatgacacgccggacggcgcgccggatccggag
ctgaagcacttctcgctggcgcggcccaagcagcacgtgtttcccaccgtccgggcggcc
ttgaagatcaatcccgagctgaaggtcatggcctcgccctggagcgcgccggcctggatg
aagaccacgggctcgctgctcaaaggccagctcaaggccgaggcctaccccgtctacgct
acgttcttcgcccgctacgttcaggaagccgccaaggtcggcgtgcccaccgactatctc
agcgtccagaacgagcctgacttcgagcccgagaactatccgggcatgcggtggctgccg
caggatcgcgcgcggttcttcggcgagcacctggccccggtgttcaagcgcgataagatc
aagacccgcgtgctcgactgggaccacaactgggaccagccccagcagccactgacggtc
ctggccgacccgaaggcgcgggctttcctgacgggcgtggcctggcactgctacgcgggc
gaggtctcggcgcaggacaaggtgcgcgcggcctatcccgacaaggaggtgttcttcacc
gagtgttcgggcggcgagtgggcgccgaagttcgacgacagcttcgcctggatggtcgag
caactgatcatcggctccacgcgcggcggcgcccgcggcgtgctgatgtggaacctggcg
ctggacgagaagttcggcccccacgcgggcggctgcggtgactgtcgcggggtggtttcg
atcgacagccaaaccggcgctttgacccgcacccaggaatactacgcctttggccacgcc
agccgctttgtgaagcccgacgcggtgcggatcggctcgccggccaaggtcgagggactt
cggaccgtggcgtttcagaaccccgatggtcagcgcgtgctgatcgtgctgaacgtgtcg
accgctgcggtcgacttcgcaattgcgtcggccggagcgcgcttcaaggcgtccttgccc
gccagatcggcgggcaccttcgtctggtag

DBGET integrated database retrieval system