KEGG   Caulobacter crescentus CB15: CC_1760Help
Entry
CC_1760           CDS       T00049                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CC_1760
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CC_1760
   3.1.2  Thioester hydrolases
    3.1.2.-  
     CC_1760
Lipid biosynthesis proteins [BR:ccr01004]
 Fatty acid synthase
  Component type
   CC_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1942296..1942928
Genome map
AA seq 210 aa AA seqDB search
MSQTAHRFPNRRRFLLGIGLLSQIAAAPKPVVITVLGDSITAGLGLPAREAMPAQLQSAL
GRRGISAVVRPAGVSGDTSGGGLARLGFSVSKDTQLCVVALGGNDLLQGVDPAQTKANLR
GVLQKLKARNVRAVLVGVAAPARIGASYARDFNAIYPSLAKEFGVPLYANILAGVVGNPA
LMQRDGIHPNAQGAKKIGEALAAVVAKAVS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccgcacaccgttttcccaaccgccgacgttttttgctggggatcggcctg
ctgagccagatcgccgccgcgccgaagccggtggtgatcaccgtgctcggcgactccatc
accgccgggctcggcttgcccgcgcgcgaggccatgcccgcgcagttacagtcagcgctg
gggcgacgtgggatctcagcggtcgtaagacccgccggcgtctcgggcgacacaagcggc
ggcggcttggcccggcttggcttcagcgtctcgaaggacacacaactctgcgtggtggcg
ctcggcggcaacgatctgctgcagggcgtcgatccggctcagaccaaggcgaaccttcgc
ggcgtgctgcagaagctcaaggcccggaacgtccgtgcggtgctggtcggcgtggccgcg
ccagccaggatcggcgccagctacgcgcgcgacttcaacgccatttatccgagcctggcc
aaggagttcggcgtgccgctttacgcgaatatcctcgcgggggtcgtcggcaatccggcg
ttgatgcagcgcgacggaattcatccgaacgctcagggcgccaagaagatcggcgaggcg
ctggccgctgtcgtcgccaaggcggtgagttag

DBGET integrated database retrieval system