KEGG   Caulobacter crescentus CB15: CC_1765Help
Entry
CC_1765           CDS       T00049                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CC_1765
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CC_1765
   00630 Glyoxylate and dicarboxylate metabolism
    CC_1765
Enzymes [BR:ccr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CC_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1948475..1950052
Genome map
AA seq 525 aa AA seqDB search
MPLDIAANIQVTAPVEGRAAEVLTPEALAFVADLHRRFDARRRQLLEARQARQARFDAGE
LPDFLDETASIRSADWTIAAIPSDLLDRRVEITGPVNRKMIINALNCGAKVFMADFEDAT
APTWANVVEGQINLKDRWQGELTHVDAKSGKAYAMGPTSAVLKIRPRGWHLMERHLEVDG
QAVAGALFDFGLYAFHNAKAAIAKGSGPYFYLPKLESHLEARLWNDVFIRAQEVLDLPVG
TIKATVLIETIPAAFEMDEILFELKDHIVGLNCGRWDYIFSFIKRLGRREAFLTPDRSAM
VMGKAFLGAYSLKLIQTCHRRGAFAMGGMAAQIPVKGDEAANNAAFAKVRADKEREAGAG
HDGTWVAHPDLVPVAMEVFNRLMPTPNQLDRKLDDLSITQAQMLELHEGSRTEAGVRENI
RVGVRYTQAWIEGRGAVPLYNLMEDAATAEICRTQLWQWVRLGAALDDGRVLSSELFVSL
FSQEMSDLRREFASPRLEEAAHIFTRMVLSDDLEEFLTIPAYELL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgacatcgccgccaacatccaggtcaccgctcccgttgaaggccgagctgcg
gaagtgctcacccccgaagccctggccttcgtcgccgatctgcaccgtcggttcgacgcg
cgtcgccgccagttgctggaagcccgtcaggcgcgccaggcgcgctttgacgccggcgaa
ctgcccgacttcctggacgagaccgcatcgatccgcagcgccgactggacgatcgcagcc
attcccagcgacctgctcgatcgccgggtcgaaatcaccgggccggtcaaccgcaagatg
atcatcaacgccttgaactgcggggccaaggtgttcatggccgacttcgaggacgccacg
gccccgacctgggccaacgtcgtcgaaggccagatcaatctgaaagaccgctggcaaggc
gagctgacccacgtcgacgcgaagtcgggcaaggcctacgccatggggccaacctccgct
gtgctgaaaatccgcccgcgcggctggcacctgatggagcgccacctagaggtcgatggc
caggccgtggccggggccctgttcgactttggcctctacgcgttccacaacgccaaggcc
gccatcgccaaaggctcagggccttacttctacctgcccaagctcgagagccacctggaa
gcacgcctgtggaatgacgtcttcatccgcgcccaggaggtgctcgacctgccggtggga
acgatcaaggccacggtgctgattgagaccatccccgccgccttcgagatggacgagatc
ctgttcgagctgaaggaccacatcgtgggcctgaactgcggccgctgggactacatcttc
tcgttcatcaagcgcctgggccgtcgcgaagcgttcctgacgccggaccgctcggccatg
gtgatgggcaaggccttcctgggcgcctattcgctgaagctgatccagacctgtcaccgc
cgtggcgcgttcgcgatgggcggcatggcggcccagatcccggtcaagggcgacgaggcc
gccaacaacgcggccttcgccaaggtccgggcagacaaggagcgggaagccggagccggc
cacgatggcacctgggtggcgcaccccgacctcgttccggtggccatggaggtgttcaac
cgcctgatgccgacgccgaaccagctcgaccgcaagctcgacgatctctcgatcactcag
gcccagatgctggagttgcacgagggttcgcgcaccgaggctggcgtccgcgaaaacatt
cgggtgggcgtccgctacacccaggcctggatcgaaggtcgcggcgcggtgccgctctac
aacctgatggaggacgcggcgaccgcagagatctgccgcacccagctctggcagtgggtg
cgcctcggcgccgcactcgacgacggccgcgtgctgagctcagaactgttcgtcagcctg
ttcagccaggagatgagcgacctgcgccgcgagttcgcctcccctcgcctggaggaagcc
gcgcacatcttcaccaggatggtgctctcggacgatctggaggagttcctgacgattcct
gcgtacgagttgctctaa

DBGET integrated database retrieval system