KEGG   Caulobacter crescentus CB15: CC_1765Help
Entry
CC_1765           CDS       T00049                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ccr01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ccr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ccr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1948475..1950052
Genome map
AA seq 525 aa AA seqDB search
MPLDIAANIQVTAPVEGRAAEVLTPEALAFVADLHRRFDARRRQLLEARQARQARFDAGE
LPDFLDETASIRSADWTIAAIPSDLLDRRVEITGPVNRKMIINALNCGAKVFMADFEDAT
APTWANVVEGQINLKDRWQGELTHVDAKSGKAYAMGPTSAVLKIRPRGWHLMERHLEVDG
QAVAGALFDFGLYAFHNAKAAIAKGSGPYFYLPKLESHLEARLWNDVFIRAQEVLDLPVG
TIKATVLIETIPAAFEMDEILFELKDHIVGLNCGRWDYIFSFIKRLGRREAFLTPDRSAM
VMGKAFLGAYSLKLIQTCHRRGAFAMGGMAAQIPVKGDEAANNAAFAKVRADKEREAGAG
HDGTWVAHPDLVPVAMEVFNRLMPTPNQLDRKLDDLSITQAQMLELHEGSRTEAGVRENI
RVGVRYTQAWIEGRGAVPLYNLMEDAATAEICRTQLWQWVRLGAALDDGRVLSSELFVSL
FSQEMSDLRREFASPRLEEAAHIFTRMVLSDDLEEFLTIPAYELL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgacatcgccgccaacatccaggtcaccgctcccgttgaaggccgagctgcg
gaagtgctcacccccgaagccctggccttcgtcgccgatctgcaccgtcggttcgacgcg
cgtcgccgccagttgctggaagcccgtcaggcgcgccaggcgcgctttgacgccggcgaa
ctgcccgacttcctggacgagaccgcatcgatccgcagcgccgactggacgatcgcagcc
attcccagcgacctgctcgatcgccgggtcgaaatcaccgggccggtcaaccgcaagatg
atcatcaacgccttgaactgcggggccaaggtgttcatggccgacttcgaggacgccacg
gccccgacctgggccaacgtcgtcgaaggccagatcaatctgaaagaccgctggcaaggc
gagctgacccacgtcgacgcgaagtcgggcaaggcctacgccatggggccaacctccgct
gtgctgaaaatccgcccgcgcggctggcacctgatggagcgccacctagaggtcgatggc
caggccgtggccggggccctgttcgactttggcctctacgcgttccacaacgccaaggcc
gccatcgccaaaggctcagggccttacttctacctgcccaagctcgagagccacctggaa
gcacgcctgtggaatgacgtcttcatccgcgcccaggaggtgctcgacctgccggtggga
acgatcaaggccacggtgctgattgagaccatccccgccgccttcgagatggacgagatc
ctgttcgagctgaaggaccacatcgtgggcctgaactgcggccgctgggactacatcttc
tcgttcatcaagcgcctgggccgtcgcgaagcgttcctgacgccggaccgctcggccatg
gtgatgggcaaggccttcctgggcgcctattcgctgaagctgatccagacctgtcaccgc
cgtggcgcgttcgcgatgggcggcatggcggcccagatcccggtcaagggcgacgaggcc
gccaacaacgcggccttcgccaaggtccgggcagacaaggagcgggaagccggagccggc
cacgatggcacctgggtggcgcaccccgacctcgttccggtggccatggaggtgttcaac
cgcctgatgccgacgccgaaccagctcgaccgcaagctcgacgatctctcgatcactcag
gcccagatgctggagttgcacgagggttcgcgcaccgaggctggcgtccgcgaaaacatt
cgggtgggcgtccgctacacccaggcctggatcgaaggtcgcggcgcggtgccgctctac
aacctgatggaggacgcggcgaccgcagagatctgccgcacccagctctggcagtgggtg
cgcctcggcgccgcactcgacgacggccgcgtgctgagctcagaactgttcgtcagcctg
ttcagccaggagatgagcgacctgcgccgcgagttcgcctcccctcgcctggaggaagcc
gcgcacatcttcaccaggatggtgctctcggacgatctggaggagttcctgacgattcct
gcgtacgagttgctctaa

DBGET integrated database retrieval system