KEGG   Caulobacter crescentus CB15: CC_1814Help
Entry
CC_1814           CDS       T00049                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00071  Fatty acid degradation
ccr00280  Valine, leucine and isoleucine degradation
ccr00281  Geraniol degradation
ccr00310  Lysine degradation
ccr00360  Phenylalanine metabolism
ccr00362  Benzoate degradation
ccr00380  Tryptophan metabolism
ccr00410  beta-Alanine metabolism
ccr00627  Aminobenzoate degradation
ccr00640  Propanoate metabolism
ccr00650  Butanoate metabolism
ccr00903  Limonene and pinene degradation
ccr00930  Caprolactam degradation
ccr01100  Metabolic pathways
ccr01110  Biosynthesis of secondary metabolites
ccr01120  Microbial metabolism in diverse environments
ccr01130  Biosynthesis of antibiotics
ccr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CC_1814
   00650 Butanoate metabolism
    CC_1814
  Lipid metabolism
   00071 Fatty acid degradation
    CC_1814
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CC_1814
   00310 Lysine degradation
    CC_1814
   00360 Phenylalanine metabolism
    CC_1814
   00380 Tryptophan metabolism
    CC_1814
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CC_1814
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CC_1814
   00281 Geraniol degradation
    CC_1814
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CC_1814
   00627 Aminobenzoate degradation
    CC_1814
   00930 Caprolactam degradation
    CC_1814
Enzymes [BR:ccr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CC_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 942239
NCBI-ProteinID: NP_420622
UniProt: Q9A7B0
Position
complement(2006798..2007625)
Genome map
AA seq 275 aa AA seqDB search
MSGYQVQEAVHDRRLGKEQMMSCLKIEVEDFVATVTLANPPVNSASVDMMLELTAAFDAF
NESPDVRAVLLTAEGKTFCAGADLKNRPGPDAPAGTAFARQRMAREMSWSMVECSKPVVV
AVNGAALGAGLGIVASCDIIVASERAVFGLPEIDVGLAGGAKHAVRFIPHSLARRMVLTG
WRVPAEELYRRGLIEAALPHEEFLDYARGIAKEIASKSPVAVAAAKDSLNVIDNLSLRDG
YRYEQGNTYKLSKSEDAKEAVRAFIEKRPPVFQGR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctaccaagttcaggaggcggtccacgaccgacgactgggcaaggagcaaatg
atgtcgtgcttgaagattgaggtcgaagacttcgttgcgacggtgacgctggccaacccg
ccggtgaactcggcgagcgtcgacatgatgctagaactcaccgcagcgttcgacgccttc
aacgaaagccccgacgtccgcgcggtgctgctgacggccgagggcaagaccttctgcgcg
ggcgctgatctgaagaaccgcccgggtcccgacgctcctgccgggacggctttcgcccgt
cagcgcatggcccgcgagatgagctggtcgatggtcgagtgcagcaagccggtcgtcgtg
gccgtcaacggcgcggccctgggcgcgggtctgggtatcgtggccagctgcgacatcatc
gtggcctcggaacgggccgtgttcggtcttcccgagatcgatgtgggcctggccggcggc
gccaagcacgccgtgcgtttcattccccattcgctggcccgccgcatggtgctcaccggc
tggcgcgtgccggccgaggagctctatcgccgcggcctgatcgaagcggcgctgccgcac
gaggagttcctggactacgcccgcggcatcgccaaggagatcgccagcaagagccccgtc
gcggtcgctgcggccaaggacagcctgaacgtcatcgacaatctgagccttcgcgacggc
taccgctatgagcagggcaacacttacaagctgtccaagagcgaagacgccaaggaggcg
gtgcgggccttcatcgaaaagcgtccgccggtcttccagggccgctga

DBGET integrated database retrieval system