KEGG   Caulobacter crescentus CB15: CC_1842Help
Entry
CC_1842           CDS       T00049                                 

Definition
response regulator
Orthology
K13591  
two-component system, cell cycle response regulator PopA
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Class
Cellular Processes; Cell growth and death; Cell cycle - Caulobacter [PATH:ccr04112]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2035367..2036692
Genome map
AA seq 441 aa AA seqDB search
MAVDARILIVARDDVRAGPLAEGLDRLGWRTITARGPYAALAALGDLPIEAVIVDMASAG
PETQTLARRLKAAVAPRRLPVIAISEPNADFRSQSFDLTLSPPLHPSQAALRLESLVRTA
IAEEEFELRLETFGERGRRLDLPEPLDAPYRILAVGEPAPQFLALSNALQASGAEVVGAF
TAYTAFDYLHERPFDSVVLWAGDSQQEALSIAAGMRRNTRLFHIPALLYLKAESYVTMSE
AFHRGVSDVASPETPEGETAMRVMELARSFRRGESIRGALEKARSSGLMDAATGLFTRDL
FAAHLARLASAARERSRPLSICVLRVADKPETVWARQNGWLDRAIPQIGSMVGRLVRVED
TPARLATEVFALALPATNQNAACAAAERIAAVIGCTAFDAGEDRAPFVCEFDIGVAEVQP
GEGAVKALERAAAAALKREAG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttggcggttgacgcccgaatcctgatcgtggcgcgtgatgatgttcgcgccggaccgctg
gccgaagggctggaccggctgggctggcgcaccatcaccgcgcggggcccctatgccgcg
ctcgccgccctgggcgatctgccgatcgaggccgtgatcgtcgacatggccagcgccggc
ccggaaacccagaccctggcgcgccggctgaaagctgcggtggcgccccggcggttgccc
gtgatcgccatcagcgagccgaacgccgatttccgcagccagtccttcgatctgacgctg
tccccgcccctgcacccctcgcaggccgcgctgcgtctggagtcgctggtgcgcacggcc
atcgccgaggaggagttcgagctgcgcctcgagaccttcggcgaacgcggtcgcaggctg
gatctgcccgagcccttggacgcgccgtatcgcatcctggcggtcggcgagcccgccccg
cagttcctggccctctccaacgccctgcaagccagcggcgcagaggtcgtcggcgccttc
acggcctatacggcctttgactatctgcacgagcggccgttcgactcggtggtgctgtgg
gccggcgacagtcagcaggaagcgctgtcgatcgccgccggcatgcggcgcaacacccgc
ctcttccacattccggcgctgctctacctgaaggccgaaagctatgtgacgatgtcggag
gcgttccatcggggggtgtccgacgtcgcctcgccggaaacgcccgagggcgagacggcc
atgcgggtcatggagctggcgcgaagcttccgtcgcggcgagtctattcgcggcgctctg
gaaaaggcgcgcagttcgggcctgatggacgccgccacagggctcttcacccgtgatctg
ttcgccgcccatctggcgcggctggccagcgccgcccgcgaacggtcgcggcccctgtcg
atctgcgttctgcgcgtcgccgacaagcccgagaccgtctgggcccgccagaacggctgg
ctggaccgcgccattccacagatcggttcgatggtggggcgcttggtgcgggtcgaggat
acgccggcgcgtctggcgaccgaggtcttcgccctggccctccccgccaccaaccagaac
gccgcctgcgccgccgccgaacggatcgccgccgtcatcggctgcaccgccttcgacgcc
ggcgaggaccgcgcgccgttcgtctgcgaattcgatatcggcgtagccgaggtccagccg
ggcgaaggcgcggtgaaggcgctcgaacgggccgccgccgccgcgctgaagcgcgaggcg
ggctga

DBGET integrated database retrieval system