KEGG   Caulobacter crescentus CB15: CC_1850Help
Entry
CC_1850           CDS       T00049                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2046644..2047705
Genome map
AA seq 353 aa AA seqDB search
MSDVETTLRGPEAYKIASRALELMERHQVWPTALNFELWTHYVADPNGALARELTRLISL
GEPMTELVSEELAATFLPKARLNEQIRDAGDILSKELEAVSKAIQNAQKSNAAFGQELAG
ASKSLDTHTDVASIKAVVGSIAEATRRVHKENQSLEARLADSTAEVERLREHLEQVRRDA
TTDGLTNLANRKAFDDELDRACAEAEEGGTTICLAVLDIDHFKGFNDTWGHQTGDQVIRY
VASVIGRVAAPPRFAARYGGEEFAMIFPREAASVVATTLEEIRVEVSSRMLKRRSTNEDL
GAITVSSGFAERKPGESGHSVMERADAALYASKRGGRNRVTAAESMPGAANAA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgtcgaaaccacgctgcgcggtccagaggcctacaagatcgcctcgcgcgct
ctggagcttatggaacggcatcaagtctggccgaccgcgctgaacttcgagctctggacg
cactatgtggccgacccgaatggcgcactggcgcgtgagctgacccgactgatctcgctg
ggcgagccgatgaccgaactggtcagcgaagagcttgccgcgacgttcctgcccaaggcg
cgcctgaacgaacagatccgcgatgcgggcgacattctgtccaaggaactggaggcggtt
tccaaggcgatccagaacgcccagaagtccaacgccgccttcggccaggaactggccggc
gcgagcaagagcctcgacacccataccgacgtcgcctcgatcaaggcggtggtcggcagc
atcgccgaagccacccgccgggtgcacaaggaaaaccagtcgctggaggcgcgtctcgcc
gactccaccgccgaagtcgaacgcctgcgcgaacatctggagcaggtgcgacgcgacgcc
acgaccgacggcctgaccaatctggccaaccgcaaggccttcgacgacgaactcgaccgc
gcctgcgccgaggccgaggaaggtggcacgaccatctgcctggcggtgctcgatatcgac
cacttcaagggcttcaacgatacctggggccaccagacgggcgaccaggtcatccgctat
gtcgcctcagtcatcggccgtgtcgccgccccgccccgcttcgccgcccgctacggcggc
gaggagttcgcgatgatcttcccccgcgaagccgcctcggtggtggcgaccacgctggag
gaaatccgcgtcgaggtgtcgtcgcgcatgctcaagcgccgctcgaccaacgaggacctg
ggcgcgatcacggtgtcctcggggttcgccgagcgtaagccgggcgagtcgggccactcg
gtgatggaacgggcggacgccgcgctctacgcctccaagcgtggtggccgcaatcgcgtg
acggccgcggagtccatgcccggcgccgccaacgccgcctga

DBGET integrated database retrieval system