KEGG   Caulobacter crescentus CB15: CC_1893Help
Entry
CC_1893           CDS       T00049                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00010  Glycolysis / Gluconeogenesis
ccr00051  Fructose and mannose metabolism
ccr00562  Inositol phosphate metabolism
ccr01100  Metabolic pathways
ccr01110  Biosynthesis of secondary metabolites
ccr01120  Microbial metabolism in diverse environments
ccr01130  Biosynthesis of antibiotics
ccr01200  Carbon metabolism
ccr01230  Biosynthesis of amino acids
Module
ccr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC_1893
   00051 Fructose and mannose metabolism
    CC_1893
   00562 Inositol phosphate metabolism
    CC_1893
Enzymes [BR:ccr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CC_1893
Exosome [BR:ccr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CC_1893
  Exosomal proteins of bladder cancer cells
   CC_1893
  Exosomal proteins of melanoma cells
   CC_1893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 942548
NCBI-ProteinID: NP_420700
UniProt: Q9A733
Position
complement(2088540..2089301)
Genome map
AA seq 253 aa AA seqDB search
MTLSSTTPRPLIAGNWKMNGLSVALDEARAVAAALEAKPPAARVAIFPPATLLHRLSQAV
EGAHLLTGGQDCHGKSSGAHTGDVSAEMVADAGGSLVICGHSERRTDHGETSAQVAGKAE
AAAAAGLEPIVCVGETLETREAGQAVSFVVSQVRDSLPTSLAGKAFSVAYEPLWAIGTGR
TASVDNIVEMHAAIRAELVSRFCEQGRTVLILYGGSVKPENAREILAAPEVGGALVGGAS
LKAKDFLAIIQAL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttcgagcacaacgccccggcctctgatcgccggaaactggaagatgaacggc
ctttcggtcgccctcgacgaggcccgagccgtcgccgccgccctggaggcgaaacctccg
gccgcccgcgtcgcgatcttcccgcccgccaccctgttgcatcgtctgagccaggcggtg
gaaggggcgcatctccttaccggcggtcaggattgccatggcaagtcgagcggcgcgcat
acgggcgatgtctccgccgagatggtcgcggacgcaggcggatcgctggtgatctgcggc
cactccgagcggcgcactgaccacggtgaaacctcagcccaggtggccggaaaggctgaa
gccgccgccgcggcgggcctggagccgatcgtctgcgtcggcgagaccctggagacccgt
gaagcgggccaggcggtaagctttgtcgtgagccaggtgcgggactcgctgccaacctcg
ctggccggcaaggcgttcagcgtggcctatgagcctctgtgggcgatcggcacgggccga
acggcttcggtcgacaacatcgtcgagatgcacgcggccatccgcgccgagctggtctcc
cgtttctgcgagcagggccggaccgtcctgatcctctatggtggctccgtgaagcccgaa
aacgctcgcgagatcctcgccgcgcccgaggttggtggcgcgctggtcggcggcgcttcg
ctgaaggccaaggacttcctggcgatcatccaggcgctttaa

DBGET integrated database retrieval system