KEGG   Caulobacter crescentus CB15: CC_1899Help
Entry
CC_1899           CDS       T00049                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CC_1899
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CC_1899
Enzymes [BR:ccr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CC_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2094921..2095709
Genome map
AA seq 262 aa AA seqDB search
MTDILAKIAAYKREDVAARKAERSQAEIDAAAKAASAPRGFKAALEAHHAPGRLSLIAEI
KKASPSKGLIREDFDPPVLAKAYEAGGAACLSVLTDGPSFQGADDYLVTARAAVALPCIR
KDFLVDPWQVAESRALGADAILVILAMIDDVLAAELMSEARRLGMDALVEVHDEAEMARA
GALGSDLVGINNRDLKSFVVDLAVTERLSAQAPRDALLVTESGIFTHDDVVRMEATGAKA
MLVGESLMRHADVTSATRALIA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacatcctggccaagatcgccgcctacaagcgtgaggacgtggcggcgcgaaaa
gccgagcggtctcaagccgagatcgacgccgccgccaaggccgcttcggcgccgcgcggc
ttcaaggccgcccttgaggcgcatcacgcgcccggccgtctctccctgatcgccgagatc
aagaaggcctcgccgtccaagggcctgatccgcgaggacttcgatccgccggtcctagcg
aaagcctatgaagccggcggcgcggcctgcctctccgtgctgaccgatggaccgagtttt
cagggcgcggatgactacctcgtcaccgcccgggcggcggtcgccctgccctgcatccgc
aaggatttcctggtcgatccctggcaagtggccgaaagccgcgccctgggcgccgacgcg
atcctggtgatcctggcgatgatcgacgacgtcctggcggcggagctgatgtccgaagcg
cgtcggctgggcatggacgcccttgtcgaggtgcacgatgaggccgaaatggcgcgcgcc
ggcgctttgggctcggatctggtcggcatcaacaaccgtgatctcaagagctttgtcgtc
gatctggcggtgaccgagcgcctgtcggcccaggccccgcgcgacgccctgctggtcacc
gaaagcggcatcttcacccatgacgatgtcgtccgcatggaagccaccggggccaaggcc
atgctggtcggcgaaagccttatgcggcacgcggacgtgacgagcgccacgcgcgccctg
atcgcttaa

DBGET integrated database retrieval system