KEGG   Caulobacter crescentus CB15: CC_1916Help
Entry
CC_1916           CDS       T00049                                 

Definition
zinc metalloprotease
Orthology
K11749  
regulator of sigma E protease [EC:3.4.24.-]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_1916
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     CC_1916
Peptidases [BR:ccr01002]
 Metallo Peptidases
  Family M50: S2P protease family
   CC_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2113721..2114917)
Genome map
AA seq 398 aa AA seqDB search
MIGFLIMLVSLLFVLSVVVTVHELGHYWAARACGVAIERFSIGFGAPLISWRDKRGVEWC
VASIPLGGYVRFAGDENAASVPDQNDLDAMRNEIRRREGDDAVNRYFHFKPVWQRAFIAV
AGPMANFILAILVFAVILVSFGAQKTSTTVGEVVAGTPAAAAGFKPGDVILKADNRQIRS
FQDIQGYVALRANMPIDFAVERDGRTVHLTATPRLVERQNEISGRVKVGELGLRSAPGGR
FERSSLLSAIPDATVEVWDMIKTIAFYLGRLLMGQLPADQISGIIGIGHTAGAVTNGVVE
QAPNGKALAIGLIYSQFWLIASLSVSIGFMNLLPIPVLDGGHLVMYAYEAVAKRPLRAEF
QAAGFRAGLALILGFMLFAAWNDLNRYDVFKFIGGLFT
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatcggctttctgatcatgcttgtgtcgctgttgttcgtgctgtccgtcgtggtgacg
gtgcacgagctgggacactattgggctgcgcgcgcttgcggcgtggccatcgagcgcttt
tccatcggatttggcgcgccgctgatttcctggcgcgacaagcgcggcgtcgagtggtgc
gtggcgtctataccgctcggcgggtacgtccgcttcgcaggcgatgagaacgccgccagc
gtgcctgaccagaacgacctcgacgcgatgcggaacgaaatccgccgtcgcgagggcgac
gacgctgtaaatcgctacttccacttcaagccggtctggcaacgcgcctttatcgccgtc
gctggtcccatggcgaacttcatcctggcgatcctggtcttcgccgtgatcctggtgtcg
ttcggcgcccagaagacgtcgacgaccgtcggtgaggttgtcgccggaacaccggcggcg
gcggccggcttcaagccgggtgacgtcatcctgaaggccgacaaccgtcagatccgatcc
ttccaggacatccagggctatgtggcgctgcgggcgaacatgccgatcgacttcgcggtc
gagcgggatgggcgcacggtgcatctcaccgcgacgccgcgcctggtggagcgccagaac
gagatcagcggccgcgttaaggtgggtgagctgggtctgcgcagtgcgccgggcggtcgg
ttcgagcgttcgtcgctgctcagcgcgatccccgacgcgaccgtcgaggtctgggacatg
atcaagaccatcgccttctatctgggccgcctgctgatgggacagcttccggctgatcag
atcagcgggatcatcggcattggtcacaccgccggcgcggtcaccaacggcgttgtcgag
caggctccgaacggcaaggccttggcgattggactgatctattcgcagttctggctcatc
gccagcctgtcggtcagcatcggtttcatgaacctgttgccgattccggttctcgatggc
ggccacctagtgatgtacgcctatgaagcggtggccaagcggcccctgcgggccgagttc
caggccgccggcttccgggcggggcttgccttgatcctgggtttcatgctgttcgcggcg
tggaacgacctcaaccgctacgacgtgttcaaattcatcggcggacttttcacgtga

DBGET integrated database retrieval system