KEGG   Caulobacter crescentus CB15: CC_1917Help
Entry
CC_1917           CDS       T00049                                 

Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00900  Terpenoid backbone biosynthesis
ccr01100  Metabolic pathways
ccr01110  Biosynthesis of secondary metabolites
ccr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CC_1917
Enzymes [BR:ccr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CC_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-GeneID: 942615
NCBI-ProteinID: NP_420724
UniProt: Q9A709
Position
complement(2114940..2116139)
Genome map
AA seq 399 aa AA seqDB search
MGALTSPRKVVVLGSTGSIGLSTLSLFEESGAPVQILALTAGRNVERLIEQARRWKPSLA
VIEDESRLDDLRAGLAGTGVEAAAGADAVRDAAAMGADWVMSAIVGAAGLAPTVAAARTG
AVIALANKESLVCAGPALLAIAKAAGGSVIPVDSEHSAIFQVLQSECAHRVSRLILTASG
GPFRTWDKAAMARATPEQAIAHPNWSMGAKISVDSATMMNKGLEMIEASYLFATPEDRVD
VVIHPQSVIHSLVEYVDGSTLAQLGPPDMRAPIACAFAWPDRLPWPAPRLDLAAYGQLTF
ESPDVERFPAIGIAREALRLGGGAPAAMNAANEVAVAAFLDRRIGFLDIAGAVAGTLERM
NSLGDLSVAESDAVETAMLIDGSARRIAAEVVAQKRQRA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgggggcattgacctctccccgcaaggtggtggtgctaggctcgaccggatcgatcggc
ctttcgaccttgagcctgttcgaagagtccggtgcgccggttcagatcctggcgctcacc
gccggtcgcaatgtcgagcgcctgatcgagcaagcgcggcgctggaagccctccctagcg
gtcatcgaggacgaaagccgtcttgatgatcttcgcgccggtctggccggtacgggcgtc
gaggcggccgccggcgccgacgcggttcgcgatgctgcggccatgggcgcggactgggtc
atgtcggccatcgtcggcgcggcgggtctggccccgacggtcgccgccgcgcgcacgggc
gccgtgatcgctctggccaacaaggagagccttgtctgcgcggggccggcgctgctggcc
atcgccaaggccgccggcgggtcggtcattcctgtcgactcggaacactcggccattttt
caggtgcttcagtccgagtgcgcgcaccgcgtatcacgcctgatcctgacggcctctggc
gggcccttccggacctgggacaaggcggctatggcccgcgccacacccgagcaggcgatc
gctcacccgaactggtcgatgggcgccaagatttcggtcgattccgcgacgatgatgaac
aagggcctcgagatgatcgaggcgtcctatctgttcgcaaccccggaagaccgcgtcgac
gtcgtgattcatccgcaatcggtgatccatagcctcgtagagtatgtcgacggttcgacc
ttggcgcagcttggcccgccggacatgcgcgcgccgatcgcctgcgccttcgcatggccg
gatcgtctgccgtggcctgcgccgcgccttgatctagccgcctacggccagctcaccttc
gaatcgcccgacgtcgagcggttccccgcaatcgggatcgcgcgcgaagcgctgaggttg
ggcgggggcgcgccggcggcgatgaacgccgccaacgaggtggccgtggctgctttcctt
gaccgccgtatcgggtttctcgatattgccggcgcggtggcggggaccctggagcggatg
aacagcctgggtgacctctccgtcgcggaaagcgacgctgtcgagaccgccatgttgatc
gatggcagcgctcgccgcattgcggccgaggttgtcgcgcagaagcgtcagcgggcctga

DBGET integrated database retrieval system