KEGG   Caulobacter crescentus CB15: CC_1917Help
Entry
CC_1917           CDS       T00049                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CC_1917
Enzymes [BR:ccr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CC_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2114940..2116139)
Genome map
AA seq 399 aa AA seqDB search
MGALTSPRKVVVLGSTGSIGLSTLSLFEESGAPVQILALTAGRNVERLIEQARRWKPSLA
VIEDESRLDDLRAGLAGTGVEAAAGADAVRDAAAMGADWVMSAIVGAAGLAPTVAAARTG
AVIALANKESLVCAGPALLAIAKAAGGSVIPVDSEHSAIFQVLQSECAHRVSRLILTASG
GPFRTWDKAAMARATPEQAIAHPNWSMGAKISVDSATMMNKGLEMIEASYLFATPEDRVD
VVIHPQSVIHSLVEYVDGSTLAQLGPPDMRAPIACAFAWPDRLPWPAPRLDLAAYGQLTF
ESPDVERFPAIGIAREALRLGGGAPAAMNAANEVAVAAFLDRRIGFLDIAGAVAGTLERM
NSLGDLSVAESDAVETAMLIDGSARRIAAEVVAQKRQRA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgggggcattgacctctccccgcaaggtggtggtgctaggctcgaccggatcgatcggc
ctttcgaccttgagcctgttcgaagagtccggtgcgccggttcagatcctggcgctcacc
gccggtcgcaatgtcgagcgcctgatcgagcaagcgcggcgctggaagccctccctagcg
gtcatcgaggacgaaagccgtcttgatgatcttcgcgccggtctggccggtacgggcgtc
gaggcggccgccggcgccgacgcggttcgcgatgctgcggccatgggcgcggactgggtc
atgtcggccatcgtcggcgcggcgggtctggccccgacggtcgccgccgcgcgcacgggc
gccgtgatcgctctggccaacaaggagagccttgtctgcgcggggccggcgctgctggcc
atcgccaaggccgccggcgggtcggtcattcctgtcgactcggaacactcggccattttt
caggtgcttcagtccgagtgcgcgcaccgcgtatcacgcctgatcctgacggcctctggc
gggcccttccggacctgggacaaggcggctatggcccgcgccacacccgagcaggcgatc
gctcacccgaactggtcgatgggcgccaagatttcggtcgattccgcgacgatgatgaac
aagggcctcgagatgatcgaggcgtcctatctgttcgcaaccccggaagaccgcgtcgac
gtcgtgattcatccgcaatcggtgatccatagcctcgtagagtatgtcgacggttcgacc
ttggcgcagcttggcccgccggacatgcgcgcgccgatcgcctgcgccttcgcatggccg
gatcgtctgccgtggcctgcgccgcgccttgatctagccgcctacggccagctcaccttc
gaatcgcccgacgtcgagcggttccccgcaatcgggatcgcgcgcgaagcgctgaggttg
ggcgggggcgcgccggcggcgatgaacgccgccaacgaggtggccgtggctgctttcctt
gaccgccgtatcgggtttctcgatattgccggcgcggtggcggggaccctggagcggatg
aacagcctgggtgacctctccgtcgcggaaagcgacgctgtcgagaccgccatgttgatc
gatggcagcgctcgccgcattgcggccgaggttgtcgcgcagaagcgtcagcgggcctga

DBGET integrated database retrieval system